KEGG   Pongo abelii (Sumatran orangutan): 100460459
Entry
100460459         CDS       T01416                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04370  VEGF signaling pathway
pon04919  Thyroid hormone signaling pathway
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100460459 (CASP9)
   04151 PI3K-Akt signaling pathway
    100460459 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100460459 (CASP9)
   04215 Apoptosis - multiple species
    100460459 (CASP9)
   04115 p53 signaling pathway
    100460459 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100460459 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460459 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100460459 (CASP9)
   05212 Pancreatic cancer
    100460459 (CASP9)
   05215 Prostate cancer
    100460459 (CASP9)
   05213 Endometrial cancer
    100460459 (CASP9)
   05222 Small cell lung cancer
    100460459 (CASP9)
   05223 Non-small cell lung cancer
    100460459 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100460459 (CASP9)
   05012 Parkinson disease
    100460459 (CASP9)
   05014 Amyotrophic lateral sclerosis
    100460459 (CASP9)
   05016 Huntington disease
    100460459 (CASP9)
   05020 Prion disease
    100460459 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    100460459 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100460459 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100460459 (CASP9)
   05152 Tuberculosis
    100460459 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100460459 (CASP9)
   05161 Hepatitis B
    100460459 (CASP9)
   05160 Hepatitis C
    100460459 (CASP9)
   05164 Influenza A
    100460459 (CASP9)
   05162 Measles
    100460459 (CASP9)
   05168 Herpes simplex virus 1 infection
    100460459 (CASP9)
   05163 Human cytomegalovirus infection
    100460459 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100460459 (CASP9)
   05169 Epstein-Barr virus infection
    100460459 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100460459 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100460459 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100460459 (CASP9)
   01002 Peptidases and inhibitors [BR:pon01002]
    100460459 (CASP9)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100460459 (CASP9)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100460459 (CASP9)
Peptidases and inhibitors [BR:pon01002]
 Cysteine peptidases
  Family C14: caspase family
   100460459 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2 AsiA
Other DBs
NCBI-GeneID: 100460459
NCBI-ProteinID: XP_002811491
Ensembl: ENSPPYG00000001844
UniProt: A0A6D2XPF7 A0A2J8S8Z4
LinkDB
Position
1
AA seq 421 aa
MDEADRRLLWRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIVRPEI
RKPEVLRPETPRPVDIGSGGFGDVGALESMRGNADLAYILSMDPCGHCLIINNVNFCRES
GLRTRTGSNIDSEKLRRRFSSLHFMVEVKGDLTAKEMVLALLELAQQDHGALDCCVVVIL
SHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHG
FEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWR
DPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKT
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggacgaagcggaccggcggctcctttggcggtgccggctgcggctggtggaggagctg
caggtggaccagctctgggacgccctgctgagccgcgagctgttcaggccccacatgatc
gaggacatccagcgggcaggctctggatctcggcgggatcaggccaggcagctgatcata
gatctagagactcgagggagtcaggctcttcctttgttcatctcctgcttagaggacaca
ggccaggacatgctggcttcgtttctacgaactaacaggcaagcagcaaagttgtcgaag
ccaaccctagaaaaccttaccccagtggtgctcagaccagagattgtcagaccagaaatt
cgcaaaccagaggttctcagaccagaaacacccagaccagtggacattggttctggagga
tttggtgatgtcggtgctcttgagagtatgaggggaaatgcagatttggcttacatcctg
agcatggatccctgtggccactgcctcattatcaacaatgtgaacttctgccgtgagtcc
gggctccgcacccgcactggctccaacattgactctgagaagttgcggcgccgcttctcc
tcgctgcatttcatggtggaggtgaagggcgacctgactgccaaggaaatggtgctggct
ttgctggagctggcgcagcaggaccacggtgctctggactgctgcgtggtggtcattctg
tctcacggctgtcaggccagccacctgcagttcccaggggctgtctacggcacagatgga
tgccctgtgtcggttgagaagattgtgaacatcttcaatgggaccagctgccccagcctg
ggagggaagcccaagctctttttcatccaggcctgtggtggggagcagaaagaccatggg
tttgaggtggcctccacttcacctgaagatgagtcccctggcagtaaccccgagccagac
gccaccccgttccaggaaggtttgaggacctttgaccagctggacgccatatctagtttg
cccacacccagtgacatctttgtgtcctactctactttcccaggttttgtttcctggagg
gaccccaagagtggctcctggtacgttgagaccctggacgacatctttgagcagtgggct
cactctgaagacctgcagtccctcctgctcagggtcgctaatgctgtttcggtgaaaggg
atttataaacagatgcctggttgctttaatttcctccggaaaaaacttttctttaaaacg
tcataa

DBGET integrated database retrieval system