KEGG   Pongo abelii (Sumatran orangutan): 100460676
Entry
100460676         CDS       T01416                                 

Gene name
FOXO1
Definition
(RefSeq) forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04910  Insulin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100460676 (FOXO1)
   04152 AMPK signaling pathway
    100460676 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100460676 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100460676 (FOXO1)
   04922 Glucagon signaling pathway
    100460676 (FOXO1)
   04919 Thyroid hormone signaling pathway
    100460676 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    100460676 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    100460676 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460676 (FOXO1)
   05202 Transcriptional misregulation in cancer
    100460676 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100460676 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100460676 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100460676 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100460676 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100460676 (FOXO1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100460676 (FOXO1)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 100460676
NCBI-ProteinID: XP_002824246
Ensembl: ENSPPYG00000005304
UniProt: H2NJQ0 A0A6D2WKC8
LinkDB
Position
13
AA seq 654 aa
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
APPQPPPPGPLSQHPPVPPAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRL
TLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
EGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGS
HSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPS
LSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNY
QKYTYGQSSMSPLPQMPMQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVD
PGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRSLPH
TVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSD
LDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1965 nt   +upstreamnt  +downstreamnt
atggccgaggcgcctcaggtggtggagatcgacccggacttcgagccgctgccccggccg
cgctcgtgcacctggccgctgcccaggccggagtttagccagtccaactcggccacctcc
agcccggcgccgtcgggcagcgcggctgccaaccccgacgccgcggcaggcctgccctcg
gcctcggctgccgctgtcagcgccgacttcatgagcaacctgagcttgctggaggagagc
gaggacttcccgcaggcgcccggctccgtggcggcggcggtggcggcggcggccgccgcg
gccgccaccggggggctgtgcggggacttccagggcccggaggcgggctgcctgcaccca
gcgccaccgcagcccccgccgcccgggccgctgtcgcagcacccgccagtgccccccgcc
gccgggccgctcgcggggcagccgcgcaagagcagctcgtcccgccgcaacgcgtggggc
aacctgtcctacgctgatctcatcaccaaggccatcgagagctcggcggagaagcggctc
acgctgtcgcagatctacgagtggatggtcaagagcgtgccctacttcaaggataagggt
gacagcaacagctcggcgggctggaagaattcaattcgtcataatctgtccctacacagc
aagttcattcgtgtgcagaatgaaggaactggaaaaagttcttggtggatgctcaatcca
gagggtggcaagagtgggaaatctcctaggagaagagctgcatccatggacaacaacagt
aaatttgctaagagccgaagccgagctgccaagaagaaagcatccctccagtctggccag
gagggtgctggggacagccctggatcacagttttccaaatggcctgcaagccctggctct
cacagcaacgatgactttgataactggagtacatttcgccctcgaactagctcaaatgct
agtactattagtgggagactctcacccattatgaccgaacaggatgatcttggagaaggg
gatgtgcattctatggtgtaccctccatctgccgcaaagatggcctctactttacccagt
ctgtctgagataagcaatcccgaaaacatggaaaatcttttggataatctcaaccttctc
tcatcaccaacatcattaactgtttcgacccagtcctcacctggcaccatgatgcagcag
acgccatgctactcgtttgcgccaccaaacaccagtttgaattcacccagcccaaactac
caaaaatatacatatggccaatccagcatgagccctttgccccagatgcctatgcaaaca
cttcaggacaataagtcgagttatggaggtatgagtcagtataactgtgcgcctggactc
ttgaaggagttgctgacttctgactctcctccccataatgacattatgacaccagttgat
cctggggtagcccagcccaacagccgggttctgggccagaacgtcatgatgggccctaat
tcagtcatgtcaacctatggcagccaggcatctcataacaaaatgatgaatcctagctcc
catacccaccctggacatgctcagcagacatctgcagttaacgggcgttccctgccccac
acggtaagcaccatgccccacacctcgggtatgaaccgcctgacccaagtgaagacacct
gtacaagtgcctctgccccaccccatgcagatgagtgccctggggggctactcctccgtg
agcagctgcaatggctatggcagaatgggccttctccaccaggagaagctcccaagtgac
ttggatggcatgttcattgagcgcttagactgtgacatggaatccatcattcggaatgac
ctcatggatggagatacattggattttaactttgacaatgtgttgcccaaccaaagcttc
ccgcacagtgtcaagacaacgacacatagctgggtgtcaggctga

DBGET integrated database retrieval system