KEGG   Pongo abelii (Sumatran orangutan): 100460820
Entry
100460820         CDS       T01416                                 

Gene name
KIF23
Definition
(RefSeq) kinesin-like protein KIF23 isoform X1
  KO
K17387  kinesin family member 23
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100460820 (KIF23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100460820 (KIF23)
   03036 Chromosome and associated proteins [BR:pon03036]
    100460820 (KIF23)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100460820 (KIF23)
Membrane trafficking [BR:pon04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    100460820 (KIF23)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100460820 (KIF23)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100460820 (KIF23)
SSDB
Motif
Pfam: Kinesin MKLP1_Arf_bdg Microtub_bd
Other DBs
NCBI-GeneID: 100460820
NCBI-ProteinID: XP_024088354
Ensembl: ENSPPYG00000006600
LinkDB
Position
15
AA seq 974 aa
MKSARAKTPRKPIVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGY
RLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTH
TMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMP
NPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFD
PIKPKWNSCSTPMRNTDFVPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKK
RRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNR
TRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGK
VRMIVCVNPKAEDYEENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNE
PLVTDVVLQSFPPLPSCEILDINDEQTLPRLIEALEKRHHLRQMMIDEFNKQSNAFKALL
QEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDK
RNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWV
KDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSASPSPVPLSSNYIAQISNGQQLMS
QPQLHRRSNSCSSISVASCISEWEQKIPTYNTPLKVTSIARRRQQEPGQSKTCIVSDRRR
GMYWTEGREVVPTFRNEIEIEEDHCCRLLFQPDQNAPPIRLRHRRSRSAGDRWVDHKPAS
NMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGG
GQSVQFTDIETLKQESPNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLG
PGYQHHAQPKRKKP
NT seq 2925 nt   +upstreamnt  +downstreamnt
atgaagtcagcgagagctaagacaccccggaaacctatcgtgaaaaaagggtcccaaacg
aaccttaaagacccagttggggtatactgtagggtgcgcccactgggctttcctgatcaa
gagtgttgcatagaagtgatcaataatacaactgttcagcttcatactcctgagggctat
agactcaaccgaaatggagactataaggagactcagtattcatttaaacaagtatttggc
actcacaccacccagaaggaactctttgatgttgtggctaatcccttggtcaatgacctc
attcatggcaaaaatggtcttctttttacatatggtgtgacgggaagtggaaaaactcac
acaatgactggttctccaggggaaggagggctgcttcctcgttgtttggacatgatcttt
aacagtatagggtcatttcaagctaaacgatatgttttcaaatctaatgataggaatagt
atggatatacagtgtgaggtcgatgccttattagaacgtcagaaaagagaagctatgccc
aatccaaagacctcttctagcaaacgacaagtagatccagagtttgcagatatgataact
gtacaagaattctgcaaagcagaagaggttgatgaagatagtgtctatggtgtatttgtc
tcttatattgaaatatataataattacatatatgatctgttggaagaggtgccgtttgat
cccataaaacccaagtggaacagttgcagcacacccatgaggaacacagattttgtacct
ccacaatctaaattgcttcgtgaagataagaaccataacatgtatgttgcaggatgtaca
gaagttgaagtgaaatctactgaggaagcttttgaagttttctggagaggccagaaaaag
agacgtattgctaatacccatttgaatcgtgagtccagccgttcacatagcgtgttcaac
attaaattagttcaggctcccttggatgcagatggagacaatgtcttacaggaaaaagaa
caaatcactataagtcagttgtccttggtagatcttgctggaagtgaaagaactaaccgg
accagagcagaagggaacagattacgtgaagctggtaatattaatcagtcactaatgacg
ctaagaacatgtatggatgtcctaagagagaaccaaatgtatggaactaacaagatggtt
ccatatcgagattcaaagttaacccatctgttcaagaactactttgatggggaaggaaaa
gtgcggatgattgtgtgtgtgaaccccaaggctgaagattatgaagaaaacttgcaagtc
atgagatttgcggaagtgactcaagaagttgaagtagcaagacctgtagacaaggcaata
tgtggtttaacgcctgggaggcgatacagaaaccagcctcgaggtccagttggaaatgaa
ccattggttactgacgtggttttgcagagttttccacctttgccttcatgcgaaattttg
gatatcaacgatgagcagacacttccaaggctgattgaagccttagagaaacgacatcac
ctacgacaaatgatgattgatgagtttaacaaacaatctaatgcttttaaagctttgtta
caagaatttgacaatgctgttttaagtaaagaaaaccacatgcaagggaaactaaatgaa
aaggaaaagatgatctcaggacagaaattggagatagaacgactggaaaagaaaaacaaa
actttagaatataagattgagattttagagaaaacaactactatctatgaggaagataaa
cgcaatttgcaacaggaacttgaaactcagaaccagaaacttcagcgacagttttctgac
aaacgcagattagaagccaggttgcaaggcatggtgacagaaacgacaatgaagtgggag
aaagaatgtgagcgtagagtggcagccaaacagctggagatgcagaataaactctgggtt
aaagatgaaaagctgaaacaactgaaggctattgttaccgaacctaaaactgagaagcca
gagagaccctctcgggagcgagatcgagaaaaagttactcaaagatctgcttctccatca
cctgtgcctctttctagtaactatattgctcagatttccaacggccagcaactcatgagc
cagccacagctacataggcgctctaactcttgcagcagcatttctgtagcttcctgtatt
tcggaatgggagcagaaaattcctacgtacaacacacctctcaaagtcacatctattgca
aggcgtaggcagcaggagccaggacaaagcaaaacttgtatcgtgtcagacagaaggcga
gggatgtactggactgaaggcagggaggtggttcctacattcagaaatgagatagaaata
gaagaggatcattgctgcaggttactctttcaacctgatcagaacgcaccaccaattcgt
ctccgacacagacgatcacgctctgcaggagacagatgggtagatcataagcccgcctct
aacatgcagactgaaacagtcatgcagccacatgtccctcatgccatcacagtatctgtt
gcaaatgaaaaggcactagctaagtgtgagaagtacatgctgacccaccaggaactagcc
tccgatggggagattgaaactaaactaattaagggtgatatttataaaacaaggggtggt
ggacaatctgttcagtttactgatattgagactttaaagcaagaatcaccaaatggtagt
cgaaaacgaagatcttccacagtagcacctgcccaaccagatggtgcagagtctgaatgg
accgatgtagaaacaaggtgttccgtggctgtggagatgagagcaggatcccagctggga
cctgggtatcagcatcacgcacaacccaagcgcaaaaagccatga

DBGET integrated database retrieval system