KEGG   Pongo abelii (Sumatran orangutan): 100460909
Entry
100460909         CDS       T01416                                 

Gene name
NRG3
Definition
(RefSeq) pro-neuregulin-3, membrane-bound isoform isoform X1
  KO
K05457  neuregulin 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100460909 (NRG3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100460909 (NRG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100460909 (NRG3)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100460909 (NRG3)
SSDB
Motif
Pfam: EGF Laminin_EGF LapA_dom EGF_2
Other DBs
NCBI-GeneID: 100460909
NCBI-ProteinID: XP_024109891
LinkDB
Position
10
AA seq 720 aa
MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVW
NRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSS
FPKAMETTTTTTSTTSPATPSAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPR
STTARNTAAPPTVLSTTAPFFSSSTPGSRPPVPGTPSTQAMPSWPTAAYATSSYLHDSTP
SWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDLAYCLN
DGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEEVYQRQ
VLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLV
KSHVQLQNYSKVERHPVTALEKMMESSFVGTQSFPEVPSPDRGSQSVKHHRSLSSCCSPG
QRSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGIEVRKTISHLPI
QLWCVERPLDLKYSSNGLKTQRNTSINMQLPSRETNPYFNCLEQKDLVGYSSTRASSVPI
IPSVGLEETCLQMPGISEVKSIKWCKNSYSADVVNVSIPVSDCLIAEQQEVKILLETVQE
QIRILTDARRSEDYELASVETEDSASENTAFLPLSPTAKSEREAQFVLRNEIQRDSALTK
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgagtgaaggggcggccgctgcctcgccacctggtgccgcttcggcagccgccgcctcg
gccgaggagggcaccgcggcggctgcggcggcggcagcggcgggcgggggcccggacggc
ggcggcgaaggggcggccgagcccccccgggagttacgctgtagcgactgcatcgtgtgg
aaccggcagcagacgtggctgtgcgtggtacctctgttcatcggcttcatcggcctgggg
ctcagtctcatgcttctcaaatggatcgtggtgggctccgtcaaggagtacgtgcccacc
gacctagtggactccaaggggatgggccaggaccccttcttcctctccaagcccagctct
ttccccaaggccatggagaccaccaccacaaccacttccaccacgtcccccgccaccccc
tccgccgggggtgccgcctcctccaggacgcccaaccggattagcactcgcctgaccacc
atcacgcgggcgcccactcgcttccccgggcaccgggtgcccatccgggccagcccgcgc
tccaccacagcacggaacactgcggcccccccgacggtcctgtccaccacggccccgttc
ttcagtagcagcacgccgggctcccgacccccggtaccaggaaccccaagtacccaggca
atgccctcctggcctactgcggcatacgctacctcctcctaccttcacgattctactccc
tcctggaccctgtcaccttttcaggatgctgcctcttcttcttcctcttcttcctcctcc
gctaccaccaccacaccagaaactagcaccagccccaaatttcatacaacgacatattcc
acagagcgatccgagcacttcaaaccctgccgagacaaggaccttgcatactgtctcaat
gatggcgagtgctttgtgatcgaaaccctgaccggatcccataaacactgtcggtgcaaa
gaaggctaccaaggagtccgttgtgatcaatttctgccgaaaactgattccatcttatcg
gatccaacagaccacttggggattgaattcatggagagtgaagaagtttatcaaaggcag
gtgctgtcaatttcatgtatcatctttggaattgtcatcgtgggcatgttctgtgcagca
ttctacttcaaaagcaagaaacaagctaaacaaatccaagagcagctgaaagtgccacaa
aatggtaaaagctacagtctcaaagcatccagcacaatggcaaagtcagagaacttggtg
aagagccatgtccagctgcaaaattattcaaaggtggaaaggcatcctgtgactgcattg
gagaaaatgatggagtcaagttttgtcggcacccagtcattccctgaggtcccttctcct
gacagaggaagccagtctgtcaaacaccacaggagtctatcctcttgctgcagcccaggg
caaagaagtggcatgctccataggaatgccttcagaaggacacccccatcaccccgaagt
aggctaggtggaattgtgggaccagcgtatcagcaactggaagaatcaaggatcccagac
caggatacgataccttgccaagggatagaggtcaggaagactatatcccacctgcctata
cagctgtggtgtgttgaaagacccctggacttaaagtattcatccaatggtttaaaaacc
caacgaaatacatcaataaatatgcaactgccttcaagagagacaaacccctattttaat
tgcttggagcaaaaggacctggtgggctattcatccacaagggccagttctgtgcccatc
atcccttcagtgggtttagaggaaacctgcctgcaaatgccagggatttctgaagtcaaa
agcatcaaatggtgcaaaaactcctattcagctgacgttgtcaatgtgagtattccagtc
agcgattgtcttatagcagaacaacaagaagtgaaaatattgctagaaactgtccaggag
cagatccgaattctgactgatgccagacggtcagaagactatgaactggccagcgtagaa
actgaggacagtgcaagcgaaaacacagcctttctccccctgagtcccaccgccaaatca
gaacgagaggcgcaatttgtcttaagaaatgaaatacaaagagactctgcattgaccaag
tga

DBGET integrated database retrieval system