KEGG   Pongo abelii (Sumatran orangutan): 100460961
Entry
100460961         CDS       T01416                                 

Gene name
FHIT
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100460961 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100460961 (FHIT)
   05223 Non-small cell lung cancer
    100460961 (FHIT)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     100460961 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 100460961
NCBI-ProteinID: XP_024100975
LinkDB
Position
3
AA seq 147 aa
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFCDLRPDEVADLFQ
ATQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHIHVLPRKAGDFHRNDSIYEKLQKH
DKEDSPASWRSEEEMAAEAAALRVYFQ
NT seq 444 nt   +upstreamnt  +downstreamnt
atgtcgttcagatttggccaacatctcatcaagccctctgtggtgtttctcaaaacagaa
ctgtccttcgctcttgtgaataggaaacctgtggtaccaggacatgtcctcgtgtgcccg
ctgcggccagtggagcgcttctgtgacctgcgtcctgatgaagtggccgatttgtttcag
gcgacccagagagtcgggacagtggtggaaaaacatttccatgggacctctctcaccttt
tccatgcaggatggccccgaagccggacagactgtgaagcacgttcacatccatgttctt
cccaggaaggctggagactttcacaggaatgacagcatctatgagaagctccagaaacat
gacaaggaggactctcctgcctcttggagatcagaggaggaaatggcagcagaagccgca
gctctgcgggtctactttcagtga

DBGET integrated database retrieval system