KEGG   Pongo abelii (Sumatran orangutan): 100460975
Entry
100460975         CDS       T01416                                 

Gene name
ERG
Definition
(RefSeq) transcriptional regulator ERG isoform X2
  KO
K09435  transcriptional regulator ERG
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05202  Transcriptional misregulation in cancer
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100460975 (ERG)
  09162 Cancer: specific types
   05215 Prostate cancer
    100460975 (ERG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100460975 (ERG)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100460975 (ERG)
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3 SAM_1 Arb2
Other DBs
NCBI-GeneID: 100460975
NCBI-ProteinID: XP_002830723
Ensembl: ENSPPYG00000011419
UniProt: H2P354 A0A6D2Y258
LinkDB
Position
21
AA seq 479 aa
MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQP
PARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTT
NERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLT
PSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEA
TQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPYQILGPTS
SRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNM
NYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGS
YHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHVPSHLGTYY
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggccagcactattaaggaagccttatcagttgtgagcgaggaccagtcattgtttgag
tgtgcctacggaacgccacacctggctaagacggagatgaccgcgtcctcctccagcgac
tatggacagacttccaagatgagcccacgcgtccctcagcaggattggctgtctcaaccc
ccagccagggtcaccatcaaaatggaatgtaaccctagccaggtgaacggctcaaggaac
tctcctgatgaatgcagtgtggccaaaggcgggaagatggtgggcagcccagacaccgtt
gggatgaactatggcagctacatggaggagaagcacatgccacccccaaacatgaccacg
aacgagcgcagagttatcgtgccagcagatcctacgctatggagtacagaccatgtgcgg
cagtggctggagtgggcggtgaaagaatatggccttccagatgtcaacatcttgttattc
cagaacatcgatgggaaggaactgtgcaagatgaccaaggacgacttccagaggctcacc
cccagctacaatgccgacatccttctctcacatctccactacctcagagagactcctctt
ccacatttgacttcagatgatgttgataaagccttacaaaactctccacggttaatgcat
gctagaaacacagggggtgcagcttttattttcccaaatacttcagtatatcctgaagct
acgcaaagaattacaactaggccagatttaccgtatgagccccccaggagatcagcctgg
accggtcatggccaccccacgccccagtcgaaagctgctcaaccatctccttccacagtg
cccaaaactgaagaccagcgtcctcagttagatccttatcagattcttggaccaacaagt
agccgccttgcaaatccaggcagtggccagatccagctttggcagttcctcctggagctc
ctgtcggacagctccaactccagctgcatcacctgggaaggcaccaacggggagttcaag
atgacagatcccgacgaggtggcccggcgctggggagagcggaagagcaaacccaacatg
aactacgataagctcagccgtgccctccgttactactatgacaagaacatcatgaccaag
gtccacgggaagcgctacgcctacaagttcgacttccacgggatcgcccaggccctccag
ccccaccccccggagtcatctctgtacaagtacccctcagacctcccgtacatgggctcc
tatcacgcccacccacagaagatgaactttgtggcgccccaccctccagccctccccgtg
acatcttccagtttttttgctgccccaaacccgtactggaattcaccaactgggggtata
taccccaacactaggctccccaccagccatgtgccttctcatctgggcacttactactaa

DBGET integrated database retrieval system