KEGG   Pongo abelii (Sumatran orangutan): 100461003
Entry
100461003         CDS       T01416                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog protein isoform X1
  KO
K11988  sonic hedgehog
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04340  Hedgehog signaling pathway
pon04360  Axon guidance
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100461003 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100461003 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461003 (SHH)
   05205 Proteoglycans in cancer
    100461003 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    100461003 (SHH)
   05217 Basal cell carcinoma
    100461003 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100461003 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100461003 (SHH)
Peptidases and inhibitors [BR:pon01002]
 Cysteine peptidases
  Family C46: hedgehog family
   100461003 (SHH)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100461003 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 100461003
NCBI-ProteinID: XP_002818767
LinkDB
Position
7
AA seq 465 aa
MGEMLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSD
FLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAAGEPEASSGSGPPSGG
ALGPRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLREEAAGAYAPLTAQGTILIN
RVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVPLPA
PGAADAPGAGAPAGVHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgggcgagatgctgctgctggcgagatgtctgctgctagtcctcgtctcctcgctgctg
gtgtgctcgggactggcgtgcggaccgggcagggggttcgggaagaggaggcaccccaaa
aagctgacccctttagcctacaagcagtttatccccaatgtggccgagaagaccctaggc
gccagcggcaggtatgaagggaagatctccagaaactctgagcgatttaaggaactcacc
cccaattacaaccccgacatcatatttaaggatgaagaaaacaccggagcggacaggctg
atgactcagaggtgtaaagacaagttgaacgctttggccatctcggtgatgaaccagtgg
ccaggagtgaaactgcgggtaaccgagggctgggacgaagatggccaccactcagaggag
tctctgcactacgagggccgcgcagtggacatcaccacgtccgaccgcgaccgcagcaag
tacggcatgctggcccgcctggcggtggaggccggcttcgactgggtgtactacgagtcc
aaggcgcacatccactgctcggtgaaagcagagaactcggtggcggccaaatcgggaggc
tgcttcccgggctcggccacggtgcacctggagcagggcggcaccaagctggtgaaggac
ctgcgccccggggaccgcgtgctggcggcggacgaccagggccggctgctctacagcgac
ttcctcactttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacg
cgggagccgcgcgagcgcctgctgctcaccgccgcgcacctgctcttcgtggcgccgcac
aacgactcggccgccggggagcccgaggcgtcctcaggctcggggccgccttccgggggc
gcactggggcctcgggcgctgttcgccagccgcgtccgcccgggccagcgcgtgtacgtg
gtggccgagcgcgacggggaccgccggctcctgcccgccgctgtgcacagcgtgacccta
cgcgaggaggccgcgggcgcctacgcgccgctcacggcccagggcaccatcctcatcaac
cgggtgctggcctcgtgctacgcggtcatcgaggagcacagctgggcgcaccgggccttc
gcgcccttccgcctggcgcacgcgctcctggctgcactggcgcccgcgcgcacggaccgc
ggcggggacagcggcggcggggaccgcgggggcggcggcggcagagtacccttgcccgcg
ccaggtgctgccgacgctccgggtgcgggggcccccgcgggcgtccactggtactcgcag
ctgctctaccaaataggcacctggctcctggacagcgaggccctgcacccgctgggcatg
gcggtcaagtccagctga

DBGET integrated database retrieval system