KEGG   Pongo abelii (Sumatran orangutan): 100461015
Entry
100461015         CDS       T01416                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04110  Cell cycle
pon04115  p53 signaling pathway
pon04218  Cellular senescence
pon04934  Cushing syndrome
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05212  Pancreatic cancer
pon05214  Glioma
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05223  Non-small cell lung cancer
pon05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100461015
   04115 p53 signaling pathway
    100461015
   04218 Cellular senescence
    100461015
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461015
   05206 MicroRNAs in cancer
    100461015
   05203 Viral carcinogenesis
    100461015
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100461015
   05225 Hepatocellular carcinoma
    100461015
   05214 Glioma
    100461015
   05220 Chronic myeloid leukemia
    100461015
   05218 Melanoma
    100461015
   05219 Bladder cancer
    100461015
   05223 Non-small cell lung cancer
    100461015
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100461015
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100461015
   05163 Human cytomegalovirus infection
    100461015
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100461015
   01522 Endocrine resistance
    100461015
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank Rbsn
Other DBs
NCBI-GeneID: 100461015
NCBI-ProteinID: XP_009242657
UniProt: A0A2J8XID9
LinkDB
Position
9
AA seq 148 aa
MEPSADWLATAAARGRVDEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGA
EPNCADPATLTRPVHDAAREGFLDTLAVLHRAGARLDVRDAWGRLPVDLAEELGHRDVAR
YLRAAAGGTRGSNHARIDAAEGPSDIPD
NT seq 447 nt   +upstreamnt  +downstreamnt
atggagccttcggctgactggctggccacggccgcggcccggggtcgggtagatgaggtg
cgggcgctactcgaggcgggggcgctgcccaacgcaccgaatagttacggtcggaggccg
atccaggtcatgatgatgggcagcgcccgcgtggcggagctgctgctgctccacggcgcg
gagcccaactgcgccgaccccgccactctcacccgacccgtgcacgacgctgcccgggag
ggcttcctggacacgctggcggtgctgcaccgggccggggcgcggctggacgtgcgcgat
gcctggggccgtctgcccgtggacctggctgaggagctgggccatcgcgatgtcgcacgg
tacctgcgcgcggctgcggggggcaccagaggcagtaaccatgcccgcatagatgccgcg
gaaggtccctcagacatccccgattga

DBGET integrated database retrieval system