KEGG   Pongo abelii (Sumatran orangutan): 100461293
Entry
100461293         CDS       T01416                                 

Gene name
MDM4
Definition
(RefSeq) protein Mdm4
  KO
K10127  protein Mdm4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04115  p53 signaling pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100461293 (MDM4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100461293 (MDM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100461293 (MDM4)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100461293 (MDM4)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB Prok-RING_4 PCSK9_C3 Cript
Other DBs
NCBI-GeneID: 100461293
NCBI-ProteinID: XP_002809612
Ensembl: ENSPPYG00000000315
UniProt: A0A6D2WEU6 A0A2J8R6R3
LinkDB
Position
1
AA seq 490 aa
MTSFSTSAQCSTSDSACRISPGQVNQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYI
MVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTL
ALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCINSREDEDLIENLTQ
DETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWF
LNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTC
EDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVP
DCRRTISAPVVRPKDVYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ
RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKE
IQLVIKVFIA
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgacatcattttccacctctgcccagtgttcaacatctgacagtgcttgcaggatctct
cctggacaagtcaatcaggtacgaccaaaactgccacttttgaagattttgcatgcagca
ggtgcgcaaggtgaaatgttcactgttaaagaggtcatgcactatttaggtcagtacata
atggtgaagcaactttatgatcagcaggagcagcatatggtatattgtggtggagatctt
ttgggagaactactgggacgtcagagcttctccgtgaaagacccaagccctctctatgat
atgctaagaaagaatcttgtcactttagccactgctactacagatgctgctcagactctc
gctctcgcacaggatcacagtatggatattccaagtcaagaccaactgaagcaaagtgca
gaggaaagttccacttccaggaaaagaactacagaagacgatatccccacactgcctacc
tcagagcataaatgcataaattctagagaagatgaagacttaattgaaaatttaacccaa
gatgagacgtctaggctggaccttggatttgaggaatgggatgtagctggcctgccttgg
tggtttttaggaaacttgagaagcaactatacacctagaagtaatggctcaactgattta
cagacaaatcaggatgtgggtactgccattgtttcagatactacagatgacttgtggttt
ttgaatgagtcagtatcagagcagttaggtgttggaataaaagttgaagctgctgatact
gaacaaacaagtgaagaagtagggaaagtaagtgacaaaaaggtgattgaagtgggaaaa
aatgatgacctggaggactctaagtccttaagtgatgataccgatgtagaagttacctgt
gaggatgagtggcaatgtactgaatgcaagaaatttaactctccaagcaagaggtactgt
tttcgttgttgggccttgaggaaggattggtattcagattgttcaaagttaacccattct
ctctccacgtctgatatcactgccatacctgaaaaggaaaatgaaggaaatgatgtccct
gattgtcgaagaaccatttcggctcctgtcgttagacctaaagatgtgtatataaagaaa
gaaaactccaaactttttgatccctgcaactcggtggaattcttggatttggctcacagt
tctgaaagccaagagaccatctcaagcatgggagaacagttagataacctttctgaacag
agaacagatacagaaaacatggaggattgccagaatctcttgaagccatgtagcttatgt
gagaaaagaccacgagacggaaacattattcatgggaggacgggccatcttgtcacttgt
tttcactgtgccagaagactaaagaaggctggggcttcatgtcctatttgtaagaaagag
attcagctggttattaaggtttttatagcataa

DBGET integrated database retrieval system