KEGG   Pongo abelii (Sumatran orangutan): 100461418
Entry
100461418         CDS       T01416                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6 isoform X1
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04217  Necroptosis
pon04650  Natural killer cell mediated cytotoxicity
pon04722  Neurotrophin signaling pathway
pon04932  Non-alcoholic fatty liver disease
pon04940  Type I diabetes mellitus
pon05022  Pathways of neurodegeneration - multiple diseases
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05168  Herpes simplex virus 1 infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05320  Autoimmune thyroid disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100461418 (FASLG)
   04014 Ras signaling pathway
    100461418 (FASLG)
   04068 FoxO signaling pathway
    100461418 (FASLG)
   04151 PI3K-Akt signaling pathway
    100461418 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100461418 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100461418 (FASLG)
   04217 Necroptosis
    100461418 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100461418 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100461418 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461418 (FASLG)
   05205 Proteoglycans in cancer
    100461418 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100461418 (FASLG)
   05330 Allograft rejection
    100461418 (FASLG)
   05332 Graft-versus-host disease
    100461418 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100461418 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100461418 (FASLG)
   04932 Non-alcoholic fatty liver disease
    100461418 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100461418 (FASLG)
   05161 Hepatitis B
    100461418 (FASLG)
   05160 Hepatitis C
    100461418 (FASLG)
   05164 Influenza A
    100461418 (FASLG)
   05162 Measles
    100461418 (FASLG)
   05168 Herpes simplex virus 1 infection
    100461418 (FASLG)
   05163 Human cytomegalovirus infection
    100461418 (FASLG)
   05165 Human papillomavirus infection
    100461418 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100461418 (FASLG)
   05143 African trypanosomiasis
    100461418 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100461418 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100461418 (FASLG)
   04052 Cytokines and growth factors [BR:pon04052]
    100461418 (FASLG)
   04090 CD molecules [BR:pon04090]
    100461418 (FASLG)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100461418 (FASLG)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Tumor necrosis fators
   100461418 (FASLG)
CD molecules [BR:pon04090]
 Proteins
  100461418 (FASLG)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100461418
NCBI-ProteinID: XP_002809835
Ensembl: ENSPPYG00000000503
UniProt: H2N4P2
LinkDB
Position
1
AA seq 280 aa
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPLPPLPPPPPP
PLPPLPLPPLKKRGNHSTRLCLLVMFFMVLVALVGLGLGMFQLFYLQKELAELRESTSQM
HTASSLEKQIGHPSPPPEKKELRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGL
VINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAR
SSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
NT seq 843 nt   +upstreamnt  +downstreamnt
atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc
tcgccctgggcccctccaggcacagttcttccctgtccaacctctgtgcccagaaggcct
ggtcaaaggaggccaccaccaccaccgccactgccaccactaccacctccgccgccgcca
ccactgcctccactaccgctgccacccctgaagaagagagggaaccacagcacacgcctg
tgtctccttgtgatgtttttcatggttctggttgccttggtaggattgggcctggggatg
tttcagctcttctacctacagaaggagctggcagaactccgagagtctaccagccagatg
catacagcatcatctttggagaagcaaataggccaccccagtccaccccctgaaaaaaag
gagctgaggaaagtggcccatttaacaggcaagcccaactcaaggtccatgcctctggaa
tgggaagacacctatggaattgtcctgctttctggagtgaagtataagaagggtggcctt
gtgatcaatgaaactgggctgtactttgtatattccaaagtatactttcggggtcaatct
tgcaacaacctgcccctgagccacaaggtctacatgaggaactctaagtatccccaggat
ctggtgatgatggaggggaagatgatgagctactgcactactgggcagatgtgggcccgc
agcagctacctgggggcagtgttcaatcttaccagtgctgatcatttatatgtcaacgta
tctgagctctctctggtcaattttgaggaatctcagacgttttttggcttatataagctc
taa

DBGET integrated database retrieval system