KEGG   Pongo abelii (Sumatran orangutan): 100461675
Entry
100461675         CDS       T01416                                 

Gene name
RASGRF1
Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 1 isoform X3
  KO
K04349  Ras-specific guanine nucleotide-releasing factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100461675 (RASGRF1)
   04014 Ras signaling pathway
    100461675 (RASGRF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100461675 (RASGRF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100461675 (RASGRF1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   100461675 (RASGRF1)
SSDB
Motif
Pfam: RasGEF RasGEF_N Sec34
Other DBs
NCBI-GeneID: 100461675
NCBI-ProteinID: XP_009248362
UniProt: A0A2J8SKM9
LinkDB
Position
15
AA seq 489 aa
MYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDMTPEKPEDPSALSKQSSEVSMREESDV
DQNQSDDGDTETSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAAS
AFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSK
HSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQ
MAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTK
HFNDISNLIASEIIRNEDINARVSTIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRL
KKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGT
PNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESS
LRIEPKLPT
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgtactcggccatgtcgcccttcagcaaggccacgctggacaccagcaagctctatgtg
tccagcagcttcaccaacaagattccagatgagggtgacatgacccctgagaagccggaa
gacccttcggcgctcagcaagcagagctcagaagtctccatgagagaggagtcagatgtt
gatcaaaaccagagtgatgatggtgatactgaaacatcaccaactaaatctccaacaaca
cccaaatcagtcaaaagcaaaaattcttcagagttcccactcttttcctataacaatgga
gtcgtcatgacctcctgtcgcgagctggacaataaccgcagtgccttgtcggctgcctcc
gcctttgccatagcaaccgcgggggccaacgagggcaccccaaacaaggagaagtaccgg
aggatgtccttagccagtgcagggtttcccccagaccagaggaacggagacaaggagttt
gtgatccgcagagcagccaccaatcgtgtcttgaacgtgctccgccactgggtgtccaag
cactctcaggactttgagaccaatgatgagctcaaatgcaaggtgatcggcttcctggaa
gaagtcatgcacgacccagagctcctgacccaggagcggaaggctgcagccaacatcatc
aggactctgacccaggaggacccaggtgacaaccagatcacgctggaggagatcacgcag
atggctgaaggcgtgaaggctgagccctttgaaaaccactcggccctggagatcgcggag
cagctgaccctactagaccacctcgtcttcaagaagattccttatgaggagttcttcgga
caaggatggatgaaactggaaaagaatgaaaggaccccttatatcatgaaaaccactaag
cacttcaatgacatcagtaacttgattgcttcagaaatcatccgcaatgaggacatcaac
gccagggtgagcaccattgagaagtgggtggccgtggctgacatatgccgctgcctccac
aactacaatgccgtgctggagatcacctcgtccatgaaccgcagtgcaatcttccggctc
aaaaagacgtggctcaaagtctctaagcagactaaagctttgattgataagctccaaaag
cttgtgtcatctgagggcagatttaagaatctcagagaagctctgaaaaattgtgaccca
ccctgtgtcccttacctggggatgtacctcaccgacctggccttcatcgaggaggggacg
cccaattacacggaagacggcctggtcaacttctccaagatgaggatgatatcccatatt
atccgagagattcgccagtttcaacaaactgcctacaaaatagagcaccaagcaaaggta
acgcaatatttactggaccaatcttttgtaatggatgaagaaagcctctacgagtcttct
ctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system