KEGG   Pongo abelii (Sumatran orangutan): 100461695
Entry
100461695         CDS       T01416                                 

Gene name
STAT5A
Definition
(RefSeq) signal transducer and activator of transcription 5A isoform X1
  KO
K11223  signal transducer and activator of transcription 5A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04217  Necroptosis
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04917  Prolactin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05161  Hepatitis B
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100461695 (STAT5A)
   04630 JAK-STAT signaling pathway
    100461695 (STAT5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100461695 (STAT5A)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100461695 (STAT5A)
   04659 Th17 cell differentiation
    100461695 (STAT5A)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100461695 (STAT5A)
   04935 Growth hormone synthesis, secretion and action
    100461695 (STAT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461695 (STAT5A)
   05203 Viral carcinogenesis
    100461695 (STAT5A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100461695 (STAT5A)
   05220 Chronic myeloid leukemia
    100461695 (STAT5A)
   05223 Non-small cell lung cancer
    100461695 (STAT5A)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100461695 (STAT5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100461695 (STAT5A)
   05161 Hepatitis B
    100461695 (STAT5A)
   05162 Measles
    100461695 (STAT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100461695 (STAT5A)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100461695 (STAT5A)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100461695
NCBI-ProteinID: XP_002827563
Ensembl: ENSPPYG00000008393
UniProt: A0A6D2WCR6 A0A2J8RF61
LinkDB
Position
17
AA seq 794 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPMELVRCIRHILYNEQRLV
REANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGGSATY
MDQAPSPAVCPQAHYNLYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLS
PPAGLFTSARGSLS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagacgcgctgcgccagatgcaggtg
ctgtacggccagcacttccccatcgaggtccggcactacttggcccagtggattgagagc
cagccatgggatgccattgacttggacaatccccaggacagagcccaagccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactatgccacgcagctccagaaaacgtatgaccgc
tgccccatggagctggtccgctgcatccggcacattctgtacaatgaacagaggctggtc
cgagaagccaacaattgcagctctccggctgggatcctggttgatgccatgtcccagaag
caccttcagatcaaccagacatttgaggagctgcgactggtcacgcaggacacagagaat
gagctgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggaaagcctg
aggatccaagctcagtttggcccactggcccagctgagcccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtctctggaggcctggttgcagcgtgaggcacag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcaa
ctggccgggaacggcgggccccccgaaggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggccgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacatcatctcagccctggtgaccagcacattcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccactgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaatgagtgcagtggtgagatcctgaacaactgc
tgcgtgatggagtaccaccaagccacgggcaccctcagcgcccacttcaggaacatgtca
ctgaagaggatcaagcgtgctgaccggcggggtgcagagtccgtgacagaggagaagttc
acagtcctgtttgagtctcagttcagtgttggcagcaatgagcttgtgttccaggtgaag
actctgtccctacctgtggttgtcatcgtccacggcagccaggaccacaatgccacggcc
accgtgctgtgggacaacgcctttgctgagccgggcagggtgccatttgccgtgcctgac
aaagtgctgtggccacagctgtgtgaggcactcaacatgaaattcaaggccgaagtacag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcccagaaactgttcaacaac
agcagcagccacctggaggactacagtggcctgtccgtgtcctggtcccagttcaacagg
gagaacttgccgggctggaactacaccttctggcagtggtttgacggggtgatggaggtg
ttgaagaagcaccacaagccccactggaatgatggggccatcctaggttttgtgaataag
caacaggcccatgacctgctcatcaacaagcccgatgggaccttcttgttgcgctttagt
gactcagaaatcgggggcatcaccatcgcctggaagtttgactccccggaacgcaacctg
tggaacctgaaaccattcaccacgcgggatttctccatcaggtccctggctgaccggctg
ggggacctgagctatctcatctatgtgtttcctgaccgccccaaggatgaggtcttctcc
aagtactacactcctgtgctggctaaagctgttgatggatatgtgaagccacagatcaag
caagtggtccctgagtttgtgaacgcatctgcagatgccgggggcggcagcgccacatac
atggaccaggccccctccccagctgtgtgcccccaggctcactataacttgtacccacag
aaccctgaccacgtactcgatcaggatggagaattcgacctggatgagaccatggatgtg
gccaggcacgtggaggaactcttacgccgaccaatggacagtcttgactcgcgcctctcg
ccccctgccggtcttttcacctctgccagaggctccctctcatga

KEGG   Pongo abelii (Sumatran orangutan): 100462537
Entry
100462537         CDS       T01416                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04062  Chemokine signaling pathway
pon04217  Necroptosis
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04917  Prolactin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05161  Hepatitis B
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100462537 (STAT5B)
   04630 JAK-STAT signaling pathway
    100462537 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100462537 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100462537 (STAT5B)
   04659 Th17 cell differentiation
    100462537 (STAT5B)
   04062 Chemokine signaling pathway
    100462537 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100462537 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    100462537 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462537 (STAT5B)
   05203 Viral carcinogenesis
    100462537 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100462537 (STAT5B)
   05220 Chronic myeloid leukemia
    100462537 (STAT5B)
   05223 Non-small cell lung cancer
    100462537 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100462537 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100462537 (STAT5B)
   05161 Hepatitis B
    100462537 (STAT5B)
   05162 Measles
    100462537 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100462537 (STAT5B)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100462537 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100462537
NCBI-ProteinID: XP_002827565
Ensembl: ENSPPYG00000008394
UniProt: H2NU10
LinkDB
Position
17
AA seq 787 aa
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG
GSATYMDQAPSPAVCSQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagctcagcagctccaaggagaagcccttcatcagatgcaagcg
ttgtatggccagcattttcccattgaggtgcggcattatttatcccagtggattgaaagc
caagcatgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactacgccacgcagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccgccatatattgtacaatgaacagaggttggtc
cgagaagctaacaatggtagctctccagctggaagccttgctgatgccatgtcccagaaa
cacctccagatcaaccagacatttgaggagctgcgactggtcacgcaggacacagagaat
gagttaaaaaagctgcagcagactcaggagtacttcatcatccagtaccaggaaagccta
aggatccaagctcagtttggcccgctggcccagctgagcccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtctctggaggcctggttgcagcgtgaggcacag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcaa
ctggccgggaacggcgggccccccgaaggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggccgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacatcatctcagccctggtgaccagcacattcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccactgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaatgattacagtggcgagatcttgaacaactgc
tgcgtcatggagtaccaccaagccacaggcacccttagtgcccacttcaggaatatgtcc
ctgaaacgaattaagaggtcagaccgtcgtggggcagagtcggtgacagaagaaaaattt
acaatcctgtttgaatcccagttcagtgttggtggaaatgagctggtttttcaagtcaag
accctgtccctgccagtggtggtgatcgttcatggcagccaggacaacaatgcgacggcc
accgttctctgggacaatgcttttgcagagcctggcagggtgccatttgccgtgcctgac
aaagtgctgtggccacagctgtgtgaggcactcaacatgaaattcaaggctgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaaactgttcaacaac
agcagcagccacctggaggactacagtggcctgtccgtgtcctggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcaatggtttgacggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggccattttggggtttgtaaacaag
caacaggcccatgacctactcattaacaagccagatgggaccttcctgctgagattcagt
gactcagaaattggcggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccattcggtccctagccgaccgcttg
ggagacttgaattaccttatctacgtgtttcctgatcggccaaaagatgaagtatactcc
aaatactacacaccagttccctgcgagtctgctactgctaaagctgttgatggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgaacgcatctgcagatgctgggggt
ggcagcgccacgtacatggaccaggccccctccccagctgtgtgctcccaggctcactat
aacatgtacccacagaaccctgactctgtccttgacaccgatggggacttcgatctggag
gacacaatggatgtagcgcggcgtgtggaggagctcctgggccggccaatggacagtcag
tggatcccgcacgcacagtcgtga

DBGET integrated database retrieval system