KEGG   Pongo abelii (Sumatran orangutan): 100461775
Entry
100461775         CDS       T01416                                 

Gene name
FRAT1
Definition
(RefSeq) proto-oncogene FRAT1
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05200  Pathways in cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100461775 (FRAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461775 (FRAT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100461775 (FRAT1)
   05226 Gastric cancer
    100461775 (FRAT1)
   05224 Breast cancer
    100461775 (FRAT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100461775 (FRAT1)
   05022 Pathways of neurodegeneration - multiple diseases
    100461775 (FRAT1)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 100461775
NCBI-ProteinID: XP_024109638
LinkDB
Position
10
AA seq 279 aa
MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVPLGSSGEVDRLVAQIGETLQLDAAQHSP
ASPCGPLGAPLRAPGPLAAAVPADKARPPAVPLLLPPVSAETVGPAPPGVLRCALGDRGR
VRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASR
RLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPL
SAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS
NT seq 840 nt   +upstreamnt  +downstreamnt
atgccgtgccggagggaggaggaagaggaagccggcgaggaggctgagggggaggaagag
gaggaggacagcttcctcctactgcagcagtcagtgccgctgggcagctcgggcgaggtg
gaccggctggtggcccagatcggcgagacgctgcagctggacgcggcgcagcacagcccg
gcctcgccgtgcgggcccctgggggcgccgctgcgggccccggggcccctggctgcggcg
gtgccggcggacaaggccaggcccccggcggtgccgctgctgctgccgcccgtgtcggcg
gagactgtgggcccggcgccccctggggtcctgcgctgcgccctgggggaccgcggccgc
gtgcggggccgcgctgcgccctactgcgtggccgagctcgccacaggccccagcgcgctg
tccccactgccccctcaggccgaccttgatgggcctccgggagctggcaagcagggcatc
ccgcagccgctgtcgggtccgtgccggcgaggatggctccggggcgccgccgcctcccgc
cgcttgcagcagcgacgcgggtcccaaccagaaacccgcacaggcgacgacgacccgcac
cggcttctgcagcagctagtgctctctggaaacctcatcaaggaggccgtgcgaaggctt
cattcgcgacggctgcagttacgtgcaaagcttccccaacgcccgctcttgggacctctg
tcggccccggtgcatgaacccccttcgcctcgcagccctcgcgcggcctgcagtgaccct
ggcgcctccgggagggcgcagctcagaactggcgacggcgttcttgtgcctggcagctaa

KEGG   Pongo abelii (Sumatran orangutan): 100462141
Entry
100462141         CDS       T01416                                 

Gene name
FRAT2
Definition
(RefSeq) GSK-3-binding protein FRAT2
  KO
K03096  frequently rearranged in advanced T-cell lymphomas 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05200  Pathways in cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100462141 (FRAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462141 (FRAT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100462141 (FRAT2)
   05226 Gastric cancer
    100462141 (FRAT2)
   05224 Breast cancer
    100462141 (FRAT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100462141 (FRAT2)
   05022 Pathways of neurodegeneration - multiple diseases
    100462141 (FRAT2)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 100462141
NCBI-ProteinID: XP_003780749
UniProt: A0A2J8XXT4
LinkDB
Position
10
AA seq 226 aa
MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSP
ASPCAPPGVPLRAPGPLAAAVPVDKARPPAVPLLLPPASAETVGPAPSGALRYAPGDRGR
VRGRAAPYCVAELAAGPSALPGPCRRGWLRDAVTSRRLQQRRWTQAGARVGDDDPHRLLQ
QLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGCSGPDPIAL
NT seq 681 nt   +upstreamnt  +downstreamnt
atgccgtgccggagggaggaggaagaggaagctggcgaggaggcggagggggaggaagag
gaggaggacagcttcctcctgctgcagcagtcggtgacgctgggtagctcgggcgaggtg
gaccggctggtggcccagatcggcgagacgctgcagctggacgcggcgcaggacagcccg
gcctcgccgtgcgcgcccccgggggtgccgctgcgggccccggggcccctggctgcggcg
gtgccggtggacaaggcccggcccccggcggtgccgctgctgctgccgcccgcgtcggct
gagacggtgggcccggcgccctctggggccctgcgctacgccccaggggaccgcggccgc
gtgcgcggacgcgctgcgccctactgcgtggccgagctcgccgcaggccccagcgcgctg
ccggggccttgccggcgaggatggctcagggacgcggtcacctcccgccgcctgcagcag
cgccgatggacccaagccggggcacgcgtcggcgacgacgacccgcatcggctcctccag
cagctcgtgctctcgggaaacctcatcaaggaagccgtgcggagactccaacgagctgtc
gccgcggttgcagccacgggccccgcaagcgcccctgggcccgggggaggctgcagcgga
cctgaccccattgccctgtag

DBGET integrated database retrieval system