KEGG   Pongo abelii (Sumatran orangutan): 100461844
Entry
100461844         CDS       T01416                                 

Gene name
PIM1
Definition
(RefSeq) serine/threonine-protein kinase pim-1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100461844 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461844 (PIM1)
   05206 MicroRNAs in cancer
    100461844 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100461844 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100461844 (PIM1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100461844 (PIM1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   100461844 (PIM1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Choline_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 100461844
NCBI-ProteinID: XP_024104651
LinkDB
Position
6
AA seq 313 aa
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgctcttgtccaaaatcaactcgcttgcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaagctggcgcccggcaaggagaaggagcccctggagtcgcagtaccaggtg
ggcccgctactgggcagcggcggcttcggctcggtctactcaggcatccgcgtctccgac
aacttgccggtggccatcaaacacgtggagaaggaccggatttccgattggggagagctg
cctaatggcactcgagtgcccatggaagtggtcctgctgaagaaggtgagctcgggtttc
tccggcgtcattaggctcctggactggttcgagaggcccgacagtttcgtcctgatcctg
gagaggcccgagccggtgcaagatctcttcgactttatcacggaaaggggggccttgcaa
gaggagctggcccgcagcttcttctggcaggtgctggaggccgtgcggcactgccacaac
tgcggggtgctccaccgcgacatcaaggacgaaaacatccttatcgacctcaatcgcggc
gagctcaagctcatcgacttcgggtcgggggcgctgctcaaggacaccgtctacacggac
ttcgatgggacccgagtgtatagccctccagagtggatccgctaccatcgctaccatggc
aggtcggcggcagtctggtccctggggatcctgctatatgatatggtgtgtggagatatt
cctttcgagcatgatgaagagatcatcaggggccaggttttcttcaggcagagggtctct
tcagaatgtcagcatctcattagatggtgcttggccctgagaccatcagataggccaacc
ttcgaagaaatccagaaccatccatggatgcaagatgttctcctgccccaggaaactgct
gagatccacctccacagcctgtcgccggggcccagcaaatag

DBGET integrated database retrieval system