KEGG   Pongo abelii (Sumatran orangutan): 100462022
Entry
100462022         CDS       T01416                                 

Gene name
DOCK1
Definition
(RefSeq) dedicator of cytokinesis protein 1 isoform X1
  KO
K13708  dedicator of cytokinesis protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04510  Focal adhesion
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100462022 (DOCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100462022 (DOCK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100462022 (DOCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100462022 (DOCK1)
   05100 Bacterial invasion of epithelial cells
    100462022 (DOCK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100462022 (DOCK1)
Membrane trafficking [BR:pon04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100462022 (DOCK1)
SSDB
Motif
Pfam: DOCK_N DHR-2 DOCK-C2 SH3_1 SH3_9 SH3_2 SR-25
Other DBs
NCBI-GeneID: 100462022
NCBI-ProteinID: XP_024109183
LinkDB
Position
10
AA seq 1886 aa
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDA
EVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQ
IVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPLALDDAI
RHKPLNMSSRFSPRVAGENDFLQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEF
PHLVDRTTAVARKTGFPEIIMPGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDG
KRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQ
DSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEE
KGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQL
MKVDGGEVVKFLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLE
TYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQL
YENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSK
MFTEFILNVPMGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEA
CCQLLSHILEVLYRKDVGPTQRHVQIIMEKLLRTVNRTVISMGRDSELIGNFVACMTAIL
RQMEDYHYAHLIKTFGKMRTDVVDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRA
INQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMR
RQIGFEIRDMWYNLGQHKIKFIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTR
SFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLME
RLLDYRTIMHDENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYT
LLLHAKLLKWSEDVCVAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKE
LAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLRGKVFIY
RGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKNSPGQYIQCFTVKPKLDLPPKFHR
PVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEV
KSVFMVEISPLENAIETMQLTNDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFT
NYEKAFFTDRYLQEHPEAHEKIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEA
CFKQLKEKVEKEYGVRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTP
SRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDI
SLQQSEAVILSETISPLRPQRPKSQVINVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSF
SMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPP
LPSKTPPPPPPKTTRKQTSVDSGIVQ
NT seq 5661 nt   +upstreamnt  +downstreamnt
atgacgcgctgggtgcccaccaagcgcgaggagaagtacggcgtggctttttataactat
gatgccagaggagcggatgaactttctttacagatcggagacactgtgcacatcttagaa
acatatgaagggtggtaccgaggttacacgttaagaaaaaagtctaagaagggtatattt
cctgcttcatatattcatcttaaagaagcgatagttgaaggaaaagggcaacatgaaaca
gtcatcccgggtgacctccccctcatccaggaagtcaccacgacactccgagagtggtcc
accatctggaggcagctctacgtgcaagataacagggagatgtttcgaagtgtgcggcac
atgatctatgaccttattgaatggcgatcacaaattctttctggaactctgcctcaggat
gaactcaaagaactgaagaagaaggtcacagccaaaattgattatggaaacagaattcta
gatttggacctggtggttagagatgaagatgggaatattttggatccagaattaactagc
acgattagtctcttcagagctcatgaaatagcttctaaacaagtggaggaaaggttacaa
gaggaaaaatctcaaaagcagaatatagatattaacagacaagccaagtttgctgcaacc
ccttctctggccttgtttgtgaacctcaaaaatgtggtttgtaaaataggagaagatgct
gaagtcctcatgtctctatatgaccctgtggagtccaaattcatcagtgagaactacctg
gttcgctggtccagttcaggattacctaaagacatagacagattacataatttgcgagcc
gtgtttactgacctcggaagcaaagacctgaaaagggagaaaatcagttttgtctgtcag
attgttcgcgtgggtcgcatggagctgagggacaacaacaccaggaaactgacctcgggg
ttgcggcgaccttttggagtggctgtgatggatgtaacagatataataaatggaaaagta
gacgatgaagataagcagcatttcattccctttcagccgctcgcgttggacgacgccatt
cgacacaagccgctgaacatgtcatcccgtttttcacccagggtggcaggggagaatgac
ttccttcagactgttataaacaaagtcatcgctgccaaagaagtcaaccacaagggtcag
ggtttgtgggtaacattgaaattacttcctggagatatccatcagatccgaaaagagttt
ccgcatttagtggacaggaccacagctgtggctcgaaaaacagggtttccggagataatc
atgcctggtgatgttcgaaatgatatctatgtaacattagttcaaggagattttgataaa
ggaagcaaaacaacagcgaagaatgtggaggtcacggtgtctgtgtacgatgaggatggg
aagcgattagagcatgtgattttcccgggtgctggtgatgaagcgatttcagagtacaaa
tctgtgatttactaccaagtaaagcagccacgctggtttgagactgttaaggtggccatt
cccatcgaggacgttaaccgcagtcaccttcggtttaccttccgccacaggtcatcccag
gactctaaggataaatctgagaaaatatttgcactagcatttgtcaagctgatgagatac
gatggtaccaccctgcgagacggagagcatgatcttatcgtctataaggccgaagcgaag
aagctggaagacgcggccacgtacttgagtctgccctctacgaaggcggagttggaagaa
aagggccactcggccacgggcaagagcatgcagagccttgggagctgcaccattagcaag
gactccttccagatctccacgctcgtgtgctccaccaaactgacccagaacgtggacctt
ctggggctcttgaagtggcgctccaacaccagcctgctgcagcagaacttgaggcagctg
atgaaagtcgatggtggtgaagtagtgaagtttcttcaggacacgttggatgccctcttc
aacatcatgatggagaactcagagagtgagacttttgacacgttagtctttgatgctctg
gtatttatcattggactgattgctgatagaaaatttcagcattttaatcctgttttggaa
acttacattaagaaacactttagtgcaacgttagcctacacgaagttgacaaaagtgttg
aagaactacgtggacggtgctgagaagccgggagtaaacgagcagctgtacaaagccatg
aaagcgctagagtccatcttcaagttcatcgtgcgctccaggatcctgttcaatcaactg
tatgaaaacaagggagaggccgatttcgtggaatctttgctgcagctcttcaggtccatc
aacgacatgatgagcagcatgtcagaccagaccgtccgggtgaagggggcagcactgaaa
tacttaccaacgatcgtcaacgatgtgaaattggtgtttgatcccaaagagctcagcaaa
atgtttactgaattcatcctcaatgttcccatgggcttgctgaccatccagaaactctac
tgcttgatcgaaatcgtccacagtgacctcttcacacagcatgactgcagagagatcctg
cttcccatgatgaccgatcagctcaagtaccatctggagagacaggaggacctggaggcc
tgctgtcagctgctcagccacatcctggaggtgctgtacaggaaggacgtggggccaact
cagaggcacgtccagatcatcatggagaaacttctccggaccgtgaaccgaaccgtcatt
tccatgggacgagattccgaactcatcggaaacttcgtggcttgcatgacagctatttta
cgacaaatggaagattaccattatgcccacttgatcaagacttttgggaaaatgaggact
gatgtggtagatttcctaatggaaacattcatcatgtttaagaacctcattggaaagaac
gtttaccccttcgactgggtgatcatgaacatggtgcagaataaagtcttcctgcgagca
attaatcagtatgcagatatgctgaacaaaaaatttctggatcaagccaactttgagcta
cagctgtggaacaactactttcacctggctgttgctttccttactcaagagtccctgcaa
ctggagaatttttcaagtgccaagagagccaaaatccttaacaagtacggagatatgagg
agacagattggctttgaaatcagagacatgtggtacaaccttggtcaacacaagataaag
ttcattccagaaatggtgggcccaatattagaaatgacattaattcccgagacggagctg
cgcaaagccaccatccccatcttctttgatatgatgcagtgtgaattccattcgacccga
agcttccaaatgtttgaaaatgagatcatcaccaagctggatcatgaagtcgaaggaggc
agaggagacgaacagtacaaagtgttatttgataaaatccttctggagcactgcaggaag
cacaaatacctcgccaaaacaggagaaacttttgtaaaactcgttgtgcgcttaatggaa
aggcttttggattatagaaccatcatgcacgacgagaacaaagaaaaccgcatgagctgc
accgtcaatgtgctgaatttctacaaagaaattgaaagagaagaaatgtatataaggtat
ttgtacaagctctgtgacctgcacaaggagtgtgataactacaccgaagcagcttacacc
ttgcttctccatgcaaagcttcttaagtggtcggaggatgtgtgtgtggcccacctcacc
cagcgggacgggtaccaggccaccacgcagggacagctgaaggagcagctctaccaagaa
atcatccactacttcgacaaaggcaagatgtgggaggaggccattgccttgggcaaggag
ctagccgagcagtatgagaatgaaatgtttgattatgagcaactcagtgaattgctgaaa
aaacaggctcagttttatgaaaacatcgtcaaagtgatcaggcccaagcctgattatttt
gctgttggctactacggacaagggttccccacattcctgcggggaaaagttttcatttac
cgagggaaagagtatgagcgccgggaagattttgaggctcggctattaactcagtttcca
aacgccgagaaaatgaagacaacatctccaccaggcgacgatattaaaaactcccctggc
cagtatattcagtgcttcacagtgaagcccaaactcgatctgcctcctaagtttcacagg
ccagtgtcagagcagatcgtaagtttttacagggtgaacgaggtccagcgatttgaatat
tctcggccaatccggaagggagagaaaaacccagacaatgaatttgcgaatatgtggatc
gagagaaccatatatacaactgcatataaattacctggaattttaagatggtttgaggtc
aagtctgttttcatggtggaaatcagccccctggagaatgctatcgagaccatgcagctg
acgaacgacaagatcaacagcatggtacagcagcacctggatgaccccagcctgcccatc
aacccgctctccatgctcctgaatggcatcgtggacccagctgtcatggggggcttcaca
aactacgaaaaggccttctttacagaccggtacctgcaggagcaccctgaggcccatgaa
aagatcgagaagctcaaggacctgattgcttggcagattccttttctggccgaagggatc
agaatccacggagacaaagtcacggaggcactgaggccgttccatgagaggatggaggcc
tgtttcaaacagctgaaggaaaaggtggagaaagagtacggcgtccgaatcatgccctca
agtctggacgatagaagaggcagccgcccccggtccatggtgcggtccttcacgatgcct
tcctcatcccggcctctgtctgtggcctctgtctcttccctctcatcggacagcacccct
tccaggccaggctccgacgggtttgccctggagcctctcctgccaaagaaaatgcactct
aggtcccaggacaagctggacaaggatgacctggagaaggagaagaaggacaagaagaag
gaaaaaaggaacagcaaacatcaagagatatttgagaaagaatttaaacccaccgacatt
tccctgcagcagtctgaggctgtgatcctttcagaaacgataagtcccctgcggccccag
agaccgaagagccaggtgatcaacgtcattggaagcgaaaggcgcttctcggtgtccccc
tcgtcaccgtcctcccagcaaacaccccctccggttacaccaagggccaagctcagcttc
agcatgcagtcgagcttggagctgaacggcatgacgggggcggacgtggccgatgtccca
ccccctctgcctctcaaaggcagcgtggccgattacgggaatttgatggaaaaccaggac
ttgctgggctcgccaacacctccacctccccctccacaccagaggcatctgccacctcca
ctgcccagcaaaactccgcctcctccccctccaaagacaactcgcaagcagacatcggtg
gactccgggatcgtgcagtga

DBGET integrated database retrieval system