KEGG   Pongo abelii (Sumatran orangutan): 100462155
Entry
100462155         CDS       T01416                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04110  Cell cycle
pon04218  Cellular senescence
pon04934  Cushing syndrome
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05212  Pancreatic cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100462155 (RB1)
   04218 Cellular senescence
    100462155 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462155 (RB1)
   05203 Viral carcinogenesis
    100462155 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100462155 (RB1)
   05225 Hepatocellular carcinoma
    100462155 (RB1)
   05226 Gastric cancer
    100462155 (RB1)
   05214 Glioma
    100462155 (RB1)
   05220 Chronic myeloid leukemia
    100462155 (RB1)
   05218 Melanoma
    100462155 (RB1)
   05219 Bladder cancer
    100462155 (RB1)
   05215 Prostate cancer
    100462155 (RB1)
   05224 Breast cancer
    100462155 (RB1)
   05222 Small cell lung cancer
    100462155 (RB1)
   05223 Non-small cell lung cancer
    100462155 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100462155 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100462155 (RB1)
   05161 Hepatitis B
    100462155 (RB1)
   05160 Hepatitis C
    100462155 (RB1)
   05163 Human cytomegalovirus infection
    100462155 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100462155 (RB1)
   05169 Epstein-Barr virus infection
    100462155 (RB1)
   05165 Human papillomavirus infection
    100462155 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100462155 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100462155 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100462155 (RB1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100462155 (RB1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    100462155 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 TFIIB
Other DBs
NCBI-GeneID: 100462155
NCBI-ProteinID: XP_002824310
LinkDB
Position
13
AA seq 928 aa
MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDQDEMPFTFTEL
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
ISTEINSSLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPVLLKEPYK
TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVESLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
NLDEEVNIIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccgaaaaacggccgccaccgctgccgctgccgccgcggaaccc
ccagcaccgccgccgccgccccctcctgaggaggacccagagcaggacagcggcccggag
gacctgcctctcgtcaggcttgagtttgaagaaacagaagaacctgattttactgcgtta
tgtcagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggagaaa
gtttcatctgtggatggagtattgggaggttatattcaaaagaaaaaggaactatgggga
atctgtatctttattgcagcagttgaccaagatgagatgccgttcacttttactgagcta
cagaaaaatatagaaatcagtgtccataaattctttaacttactaaaagaaatcgatacc
agtaccaaagttgataatgctatgtcaagactgttgaagaagtatgatgtattgtttgca
ctcttcagcaaattggaaaggacatgtgaacttatatatttgacacaacccagcagttcg
atatctactgaaataaattcttcattggtgctaaaagtttcttggatcacatttttatta
gctaaaggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatgcta
tgtgtccttgactattttattaaactctcacctcccgtgttgctgaaagaaccatataaa
acagctgttatacccattaatggttcacctcgaacacccaggagaggtcagaacaggagt
gcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaa
catgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatg
aattctcttggacttgtaacatctaatggacttccagaggttgaaagtctgtctaaacga
tatgaagaaatttatcttaaaaataaagatctagatgcaagattatttttggatcatgat
aaaactcttcagactgattctatagacagttttgaaacacagagaacaccacgaaaaagt
aaccttgatgaagaggtgaatataattcctccacacactccagttaggactgttatgaac
actatccaacaattaatgatgattttaaattcagcaagtgatcaaccttcagaaaatctg
atttcctattttaacaactgcacagtgaatccaaaagaaagtatactgaaaagagtgaag
gatataggatacatctttaaagagaaatttgctaaagctgtgggacagggatgtgtcgaa
attggatcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatccatg
cttaaatcagaagaagaacgattatccattcaaaattttagcaaacttctgaatgacaac
atttttcatatgtctttattggcgtgcgctcttgaagttgtaatggccacatatagcaga
agtacatctcagaatcttgattctggaacagatttgtctttcccatggattctgaatgtg
cttaatttaaaagcctttgatttttacaaagtgattgaaagttttatcaaagcagaaggc
aacttgacaagagaaatgataaaacatttagaacgatgtgaacatcgaatcatggaatcc
cttgcatggctctcagattcacctttatttgatcttattaaacaatcaaaggaccgagaa
ggaccaactgatcaccttgaatctgcttgtcctcttaatcttcctctccagaataatcac
actgcagcagatatgtatctttctcctgtaagatctccaaagaagaaaggttcaactaca
cgtgtaaattctactgcaaatgcagagacacaagcaacctcagccttccagacccagaag
ccattgaaatctacctctctgtcactgttttataaaaaagtgtatcggctggcctatctc
cggctaaatacactttgtgaacgccttctgtctgagcacccagaactagaacacatcatc
tggacccttttccagcacaccctgcagaatgagtatgaactcatgagagacaggcatttg
gaccaaattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaa
ttcaaaatcattgtaacagcatacaaggatcttcctcatgctgttcaggagacattcaaa
cgtgttttgatcaaagaagaggagtatgattctattatagtattctataactcggtcttc
atgcagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtca
ccaatacctcacattcctcgaagcccttacaagtttcctagttcacccttacggattcct
ggagggaacatctatatttcacccctgaagagtccatataaaatttcagaaggtctgccg
acaccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcatttggg
acttctgagaagttccagaaaataaatcagatggtgtgtaacagcgaccgtgtgctcaaa
agaagtgctgaaggaagcaaccctcctaaaccgctgaaaaaactacgctttgatattgaa
ggatcagatgaagcagatggaagtaaacatctcccaggagagtccaaatttcagcagaaa
ctggcagaaatgacttctactcgaacacgaatgcaaaagcagaaaatgaatgatagcatg
gatacctcaaacaaggaagagaaatga

DBGET integrated database retrieval system