KEGG   Pongo abelii (Sumatran orangutan): 100462160
Entry
100462160         CDS       T01416                                 

Gene name
DICER1
Definition
(RefSeq) endoribonuclease Dicer isoform X1
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100462160 (DICER1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100462160 (DICER1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     100462160 (DICER1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    100462160 (DICER1)
   microRNA pathway
    RISC loading complex
     100462160 (DICER1)
SSDB
Motif
Pfam: Ribonuclease_3 PAZ Dicer_dimer Ribonucleas_3_3 Helicase_C ResIII DEAD dsrm
Other DBs
NCBI-GeneID: 100462160
NCBI-ProteinID: XP_009247731
Ensembl: ENSPPYG00000006112
UniProt: A0A6D2VSB6 A0A2J8TLN5
LinkDB
Position
14
AA seq 1922 aa
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNT
IVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLK
VGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA
ILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDL
VVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISK
QILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCE
EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDDYVSWSDSEDDDE
DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFIT
GHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLP
TEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETD
IDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD
GTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETV
KYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYLYVIGMVLTTP
LPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSL
QMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDI
EKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKF
PSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKR
KAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGV
GVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDNYCKHSTIVPENAAHQGANRT
SSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGN
QQNYYKQEIPVQPATSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAV
MPGTTDAIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGD
SFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNW
LPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYED
DFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSDFED
FDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIA
DCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVS
CAAASVASSRSSVLKDLEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNK
AYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALV
NNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEE
DIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEM
EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVP
NS
NT seq 5769 nt   +upstreamnt  +downstreamnt
atgaaaagccctgctttgcaacccctcagcatggcaggcctgcagctcatgacccctgct
tcctcaccaatgggtcctttctttggactgccatggcaacaagaagcaattcatgataac
atttatacgccaagaaaatatcaggttgaactgcttgaagcagctctggatcataatacc
atcgtctgtttaaacactggctcagggaagacatttattgcagtactactcactaaagag
ctgtcctatcagatcaggggagacttcagcagaaatggaaaaaggacggtgttcttggtc
aactctgcaaaccaggttgctcaacaagtgtcagctgtcagaactcattcagatctcaag
gttggggaatactcaaacctagaagtaaatgcatcttggacaaaagagagatggaaccaa
gagtttactaagcaccaggttctcattatgacttgctatgtcgccttgaatgttttgaaa
aatggttacttatcactgtcagacattaaccttttggtgtttgatgagtgtcatcttgca
atcctagaccacccctatcgagaaattatgaagctctgtgaaaattgtccatcatgtcct
cgcattttgggactaactgcttccattttaaatgggaaatgtgatccagaggaattggaa
gaaaagattcagaaactagagaaaattcttaagagtaatgctgaaactgcaactgacctg
gtggtcttagacaggtatacttctcagccatgtgagattgtggtggattgtggaccattt
actgacagaagtgggctttatgaaagactgctgatggaattagaagaagcacttaatttt
atcaatgattgtaatatatctgtacattcaaaagaaagagattctactttaatttcgaaa
cagatactatcagactgtcgtgccgtattggtagttctgggaccctggtgtgcagataaa
gtagctggaatgatggtaagagaactacagaaatacatcaaacatgagcaagaggagctg
cacaggaaatttttattgtttacagacactttcctaaggaaaatacatgcactatgtgaa
gagcacttctcacctgcctcacttgacctgaaatttgtaactcctaaagtcatcaaactg
ctcgaaatattacgcaaatataaaccatatgagcgacagcagtttgaaagcgttgagtgg
tataataatagaaatcaggatgattatgtgtcatggagtgattctgaggatgatgatgag
gatgaagaaattgaagaaaaagagaagccagagacaaattttccttctccttttaccaac
attttgtgtggaattatttttgtggaaagaagatacacagcagttgtcttaaacagattg
ataaaggaagctggcaaacaagatccagagctggcttatatcagtagcaattttataact
ggacatggcattgggaagaatcagcctcgcaacaaacagatggaagcagaattcagaaaa
caggaagaggtacttaggaaatttcgagcacatgagaccaacctgcttattgcaacaagt
attgtagaagagggtgttgatataccaaaatgcaacttggtggttcgttttgatttgccc
acagaatatcgatcctatgttcaatctaaaggaagagcaagggcacccatctctaattat
ataatgttagcggatacagacaaaataaaaagttttgaagaagaccttaaaacctacaaa
gctattgaaaagatcttgagaaacaagtgttccaagtcggttgatactggtgagactgac
attgatcctgtcatggatgatgatgacgttttcccaccatatgtgttgaggcctgacgat
ggtggtccacgagtcacaatcaacacggccattggacacatcaatagatactgtgctaga
ttaccaagtgatccgtttactcatctagctcctaaatgcagaacccgagagttgcctgat
ggtacattttattcaactctttacctgccaattaactcacctcttcgagcctccattgtt
ggtccaccaatgagctgtgtacgattggctgaaagagttgtagctctcatttgctgtgag
aaactgcacaaaattggtgaactggatgaccatttgatgccagttgggaaagagactgtt
aaatatgaagaagagcttgatttgcatgatgaagaagagaccagtgttccgggaagacca
ggttccacgaaacgaaggcagtgctatccaaaagcaattccagagtgtttgagggatagt
tatcccagacctgatcagccctgttacctgtatgtgataggaatggttttaactacacct
ttacctgatgaactcaactttagaaggcggaagctctatcctcctgaagataccacaaga
tgctttggaatactgacagccaaacccatacctcagattccacactttcctgtgtacaca
cgctctggagaggttaccatatccattgagttgaagaagtctggtttcatgttgtctcta
caaatgcttgagttgattacaagacttcaccagtatatattctcacatattcttcggctt
gaaaaacctgcactagaatttaaacctacagacgctgattcagcatactgtgttctacct
cttaatgttgttaatgactccagcactttggatattgactttaaattcatggaagatatt
gagaagtctgaagctcgcataggcattcccagtacaaagtatacaaaagaaacacccttt
gtttttaaattagaagattaccaagatgctgttatcattccaagatatcgcaattttgat
cagcctcatcgattttatgtagctgatgtgtacactgatcttaccccactcagtaaattt
ccttcccctgagtatgaaacttttgcagaatattataaaacaaagtacaaccttgaccta
accaatctcaaccagccactgctggatgtggaccacacatcttcaagacttaatcttttg
acacctcgacatttgaatcagaaggggaaagctcttcctttaagcagtgctgagaagagg
aaagccaaatgggaaagtctgcagaataaacagatactggttccagaactctgtgctata
catccgattccagcatcactgtggagaaaagctgtttgtctccccagcatactttatcgc
cttcactgccttttgactgcagaggagctaagagcccagactgccagcgatgctggcgtg
ggagtcagatcacttcctgcggattttagataccctaacttagacttcgggtggaaaaaa
tctattgacagcaaatctttcatctcaatttctaactcctcttcagctgaaaatgataat
tactgtaagcacagcacaattgtccctgaaaatgctgcacatcaaggtgctaatagaacc
tcctctctagaaaatcatgaccaaatgtctgtgaactgcagaacgttgctcagcgagtcc
cctggtaagctccacgttgaagtttcagcagatcttacagcaattaacggtctttcttac
aatcaaaatctcgccaatggcagttatgatttagctaacagagacttttgccaaggaaat
cagcagaattactacaagcaggaaatacccgtgcaaccagctacctcatattccattcag
aatttatacagttacgagaaccagccccagcccagcgatgaatgtactctcctgagtaat
aaataccttgatggaaatgctaacaaatctacctcagatggaagtcctgtgatggccgta
atgcctggtacgacagacgctattcaagtgctcaagggcaggatggattctgagcagagc
ccttctattgggtactcctcaaggactcttggccccaatcctggacttattcttcaggct
ttgactctgtcaaacgctagtgatggatttaacctggagcggcttgaaatgcttggcgac
tcctttttaaagcatgccatcaccacgtatctattttgcacttaccctgatgctcatgag
ggccgcctttcgtatatgagaagcaaaaaggtcagcaactgtaatctgtatcgccttgga
aaaaagaagggactacccagccgcatggtggtgtcaatatttgatccccctgtgaattgg
cttcctcctggttatgtagtaaatcaagacaaaagcaacacagataaatgggaaaaagat
gaaatgacaaaagactgcatgctggcgaatggcaaactggatgaggattacgaggaggag
gatgaggaggaggagagcctgatgtggagggctccgaaggaagaggctgactatgaagat
gatttcctggagtatgatcaggaacatatcagatttatagataatatgttaatggggtca
ggagcttttgtaaagaaaatctctctttctcctttttcaaccactgattctgcatatgaa
tggaaaatgcccaaaaaatcctccttaggtagtatgccattttcatcagattttgaggat
tttgactacagctcttgggatgcaatgtgctatctggatcctagcaaagctgttgaagaa
gatgactttgtggtggggttctggaatccatcagaagaaaactgtggtgttgacacggga
aagcagtccatttcttacgacttgcacactgagcagtgtattgctgacaaaagcatagcg
gactgtgtggaagccctgctgggctgctatttaaccagctgtggggagagggctgctcag
cttttcctctgttcattggggctgaaggtgctcccggtaattaaaaggactgatcgggaa
aaggccctgtgccctactcgggagaatttcaacagccaacaaaagaacctttcagtgagc
tgtgctgctgcttctgtggccagttcacgctcttctgtattgaaagacttggaatatggt
tgtttgaagattccaccaagatgtatgtttgatcatccagatgcagataaaacactgaat
caccttatatcggggtttgaaaattttgaaaagaaaatcaactacagattcaagaataag
gcttaccttctccaggcttttacacatgcctcctaccactacaatactatcactgattgt
taccagcgcttagaattcctgggagatgcgattttggactacctcataaccaagcacctt
tatgaagacccgcggcagcactccccgggggtcctgacagacctgcggtctgccctggtc
aacaacaccatctttgcatcgctggctgtaaagtacgactaccacaagtacttcaaagct
gtctctcctgagctcttccatgtcattgatgactttgtgcagtttcagcttgagaagaat
gaaatgcaaggaatggattctgagcttaggagatctgaggaggatgaagagaaagaagag
gatattgaagttccaaaggccatgggggatatttttgagtcgcttgctggtgccatttac
atggatagtgggatgtcactggagacagtctggcaggtgtactatcccatgatgcggccg
ctaatagaaaagttttctgcaaatgtaccccgttcgcctgtgcgagaattgcttgaaatg
gaaccagaaactgccaaatttagcccggccgagagaacttacgacgggaaggtcagagtc
accgtggaagtggtaggaaaggggaagtttaaaggtgttggtcgaagttacaggatcgcc
aaatctgcagcggcaagaagagccctccgaagcctcaaagctaatcaacctcaggttccc
aatagctga

DBGET integrated database retrieval system