KEGG   Pongo abelii (Sumatran orangutan): 100462290
Entry
100462290         CDS       T01416                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04024  cAMP signaling pathway
pon04210  Apoptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04668  TNF signaling pathway
pon04713  Circadian entrainment
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04932  Non-alcoholic fatty liver disease
pon04935  Growth hormone synthesis, secretion and action
pon05031  Amphetamine addiction
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05161  Hepatitis B
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05224  Breast cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05323  Rheumatoid arthritis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100462290 (FOS)
   04668 TNF signaling pathway
    100462290 (FOS)
   04024 cAMP signaling pathway
    100462290 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100462290 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100462290 (FOS)
   04660 T cell receptor signaling pathway
    100462290 (FOS)
   04658 Th1 and Th2 cell differentiation
    100462290 (FOS)
   04659 Th17 cell differentiation
    100462290 (FOS)
   04657 IL-17 signaling pathway
    100462290 (FOS)
   04662 B cell receptor signaling pathway
    100462290 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100462290 (FOS)
   04917 Prolactin signaling pathway
    100462290 (FOS)
   04921 Oxytocin signaling pathway
    100462290 (FOS)
   04926 Relaxin signaling pathway
    100462290 (FOS)
   04935 Growth hormone synthesis, secretion and action
    100462290 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    100462290 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    100462290 (FOS)
   04728 Dopaminergic synapse
    100462290 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100462290 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100462290 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462290 (FOS)
   05231 Choline metabolism in cancer
    100462290 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100462290 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100462290 (FOS)
   05224 Breast cancer
    100462290 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100462290 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    100462290 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100462290 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100462290 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100462290 (FOS)
   05135 Yersinia infection
    100462290 (FOS)
   05133 Pertussis
    100462290 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100462290 (FOS)
   05170 Human immunodeficiency virus 1 infection
    100462290 (FOS)
   05161 Hepatitis B
    100462290 (FOS)
   05171 Coronavirus disease - COVID-19
    100462290 (FOS)
   05162 Measles
    100462290 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100462290 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100462290 (FOS)
   05142 Chagas disease
    100462290 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100462290 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100462290 (FOS)
   04131 Membrane trafficking [BR:pon04131]
    100462290 (FOS)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100462290 (FOS)
Membrane trafficking [BR:pon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100462290 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 100462290
NCBI-ProteinID: XP_002824996
Ensembl: ENSPPYG00000006002
UniProt: A0A6D2W783 A0A2J8W665
LinkDB
Position
14
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcccgctgcagcagcgcg
tccccggccggggatagcctctcctactaccactcacccgccgactccttctccagcatg
ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc
attcccacggtcactgccatctcgaccagtccggacctgcagtggctggtgcagcctgcc
ctcgtctcctccgtggccccatcgcagaccagagcccctcaccctttcggagtccccacc
ccctccgctggggcttactccagggctggcgttgtgaagaccatgacaggaggccgagcg
cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacctgctaaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc
cttgatctgactgggggcctgccagaggttgccaccccggagtctgaggaggccttcacc
ctgcctctcctcaatgaccctgagcccaagccctcagtggaacctgtcaagagcatcagc
agcatggagctgaaggccgagccgtttgatgacttcctgttcccagcatcatccaggccc
agcggctctgagacagcccgctctgtgccagacatggacctatctgggtccttctatgca
gcagactgggagcctctgcacagtggctccctgggaatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgcgcagctgcccaccgcaag
ggcagcagcagcaatgagccttcctctgactcgctcagctcacccacgctgctggcccta
tga

DBGET integrated database retrieval system