KEGG   Pongo abelii (Sumatran orangutan): 100936620
Entry
100936620         CDS       T01416                                 

Gene name
TERT
Definition
(RefSeq) LOW QUALITY PROTEIN: telomerase reverse transcriptase
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100936620 (TERT)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100936620 (TERT)
   05226 Gastric cancer
    100936620 (TERT)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100936620 (TERT)
   05165 Human papillomavirus infection
    100936620 (TERT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pon03032]
    100936620 (TERT)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     100936620 (TERT)
DNA replication proteins [BR:pon03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    100936620 (TERT)
   Telomerase complex (fungi)
    100936620 (TERT)
SSDB
Motif
Pfam: Telomerase_RBD RVT_1
Other DBs
NCBI-GeneID: 100936620
NCBI-ProteinID: XP_024103237
LinkDB
Position
5
AA seq 1132 aa
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGARNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGTRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPDRTRGPSDRGFCVVSPARPAKEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTTCPPMYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLRRLPQRYWQMRPLFLELLGNHVQCPYGVLLKTHCPLRAAVI
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSETEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAPRLTSRVKA
LFSVLNYERARRPSLLGASVLGLDDIHRAWRTFVLRVRXQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFVCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKAFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQLPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASITF
NRGFKPGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTACLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLAALEAAANPALPSDFKTILD
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgccgcgcgctccccgctgccgagccgtgcgctccctgctgcgcagccactaccgcgag
gtgctgccgctggccacgttcgtgcggcgcctggggccccagggctggcggctggtgcag
cgcggggacccggcggctttccgcgcgctggtggcccagtgtctggtgtgcgtgccctgg
gacgcacggccgccccccgccgccccctccttccgccaggtgtcctgcctgaaggagctg
gtggcccgggtgctgcagaggctatgcgagcgcggcgcgaggaacgtgctggccttcggc
ttcgcgctgctggacggggcccgcggcggccccccagaggccttcaccaccagcgtgcgc
agctacctgcccaacacggtgaccgacgcactgcgggggagcggggcgtgggggctgctg
ctgcgccgcgtgggcgacgacgtgctggttcacctgctggcacgctgcgcgctctttgtg
ctggtggctcccagctgcgcctaccaggtgtgcggaccgccgctgtaccagctcggcgct
gccactcaggcccggcccccgccacacgctagtggaacccgaaggcgtctgggatgcgaa
cgggcctggaaccatagcgtaagggaggccggggtccccctgggcctgccagccccgggt
gcgaggaggcgcgggggcagtgccagccgaagtctgccgttgcccaagaggcccaggcgt
ggggctgcccctgagccggagcggacgcccgttgggcaggggtcctgggcccacccggac
aggactcgtggaccgagtgaccgtggtttctgtgtggtgtcacctgccagacccgccaaa
gaagccacctctttggagggtgcgctctctggcacgcgccactcccacccatccgtgggc
cgccagcaccacgcgggccccccatccacatcgcggccaccacgtccctgggacacgact
tgtcccccgatgtacgccgagaccaagcacttcctctactcctcaggcgacaaggagcag
ctgcggccttccttcctactcagctctctgaggcccagcctgactggcgctcggaggctg
gtggagaccatttttctgggttccaggccctggatgccagggactccccgcaggttgcgc
cgcctgccccagcgctactggcaaatgcggcccctgtttctggagctgcttgggaaccat
gtgcagtgcccctacggggtgctcctcaagacgcactgcccgctgcgggctgcagtcatc
ccagcagccggtgtctgtgcccgggagaagccccagggctctgtggcggcccccgaggag
gaggacacagacccccgtcgcctggtgcagctgctccgccagcacagcagcccctggcag
gtgtacggcttcgtgcgggcctgcctgcgccggctggtgcccccaggcctctggggctcc
aggcacaacgaacgccgcttcctcaggaacaccaagaagttcatctctctggggaagcat
gccaagctctcgctgcaggagctgacgtggaagatgagcgtgcgggactgcgcttggctg
cgcaggagcccaggggttggctgtgttccggccgcagagcaccgtctgcgtgaggagatc
ctggccaagttcctgcactggctgatgagcgtgtacgtcgtcgagctgctcaggtctttc
ttttatgtcacggagaccacgtttcagaagaacaggctctttttctaccggaagagtgtc
tggagcaagttgcaaagcattggaatcagacagcacttgaagagggtgcagctgcgggag
ctgtcagaaacagaggtcaggcagcatcgggaagccaggcccgccctgctgacgtccaga
ctccgcttcatccccaagcctgacgggctccggccaattgtgaacatggactacgtcgtg
ggagccagaacattccgcagagaaaagagggcaccccgtctcacctcgagggtgaaggca
ctgttcagcgtgctcaactacgagcgggcgcggcgccccagcctcctgggcgcctctgtg
ctgggcctggacgatatccacagggcctggcgcacctttgtgctgcgtgtgcggncccag
gacccgccacctgagctgtactttgtcaaggttgatgtgacaggcgcgtacgacaccatc
ccccaggacaggctcacggaggtcatcgccagcatcatcaaaccccagaacacgtactgc
gtgcgtcggtatgctgtggtccagaaggccgcccatgggcacgtccgcaaggccttcaag
agccatgtctctaccttgacagacctccagccgtacatgcgacagttcgtggctcacctg
caggagaccagcccgctgagggatgccgtcgtcatcgagcagagctcctccctgaatgag
gccagcagtggcctcttcgacgtcttcctgcgcttcgtgtgccaccacgctgtgcgcatc
aggggcaagtcctacgtccagtgccaggggatcccgcagggctccatcctgtccacactg
ctctgcagcctgtgctacggcgacatggagaacaagctgttcgcggggattcggcgggac
gggctgctcctgcgtttggtggatgatttcttgttggtgacacctcacctcacccacgcg
aaagccttcctcaggaccctggtccgaggtgtccctgagtatggctgcgtggtgaacttg
cggaagacagtggtgaacttccctgtagaagatgaggccctgggtggcacggcttttgtt
cagctgccagcccacggcctattcccctggtgtggcctgctgctggacacccggaccctg
gaggtgcagagcgactactccagctacgcccggacctccatcagagccagtattaccttc
aaccgcggcttcaagcctgggaggaacatgcgtcgcaaactctttggggtcttgcggctg
aagtgtcacagcctgtttctggatttgcaggtgaacagcctccagacggtgtgcaccaac
atctacaagatcctcctgctgcaggcatacaggttccacgcatgtgtgctgcagctccca
tttcatcagcaagtttggaagaaccccacatttttcctgcgcgtcatctctgacacggcc
tgcctctgctactccatcctgaaagccaagaacgcagggatgtcactgggggccaagggc
gccgccgggcctctgccctccgaggccgtgcagtggctgtgccaccaagccttcctgctc
aagctgactagacaccgcgtcacctacgtgccactcctggggtcactcaggacagcccag
acgcagctgagtcggaagctcccagggacgacgctggctgccctggaggctgcagccaac
ccggcactgccctcagacttcaagaccatcctggactga

KEGG   Pongo abelii (Sumatran orangutan): 100936787
Entry
100936787         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: telomerase reverse transcriptase-like
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100936787
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100936787
   05226 Gastric cancer
    100936787
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100936787
   05165 Human papillomavirus infection
    100936787
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pon03032]
    100936787
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     100936787
DNA replication proteins [BR:pon03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    100936787
   Telomerase complex (fungi)
    100936787
SSDB
Motif
Pfam: Telomerase_RBD RVT_1
Other DBs
NCBI-GeneID: 100936787
NCBI-ProteinID: XP_024102910
LinkDB
Position
5
AA seq 862 aa
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGARNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGTRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPDRTRGPSDRGFCVVSPARPAKEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTTCPPMYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLRRLPQRYWQMRPLFLELLGNHVQCPYGVLLKTHCPLRAAVI
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSETEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPSLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVLLSQSSSXIEASSGLFDVFLRFVCHHAVRIRGKSYVQSRGSPQGSILSTL
LCSLCNGDMENKLFAGIRRDDY
NT seq 2589 nt   +upstreamnt  +downstreamnt
atgccgcgcgctccccgctgccgagccgtgcgctccctgctgcgcagccactaccgcgag
gtgctgccgctggccacgttcgtgcggcgcctggggccccagggctggcggctggtgcag
cgcggggacccggcggctttccgcgcgctggtggcccagtgtctggtgtgcgtgccctgg
gacgcacggccgccccccgccgccccctccttccgccaggtgtcctgcctgaaggagctg
gtggcccgggtgctgcagaggctatgcgagcgcggcgcgaggaacgtgctggccttcggc
ttcgcgctgctggacggggcccgcggcggccccccagaggccttcaccaccagcgtgcgc
agctacctgcccaacacggtgaccgacgcactgcgggggagcggggcgtgggggctgctg
ctgcgccgcgtgggcgacgacgtgctggttcacctgctggcacgctgcgcgctctttgtg
ctggtggctcccagctgcgcctaccaggtgtgcggaccgccgctgtaccagctcggcgct
gccactcaggcccggcccccgccacacgctagtggaacccgaaggcgtctgggatgcgaa
cgggcctggaaccatagcgtaagggaggccggggtccccctgggcctgccagccccgggt
gcgaggaggcgcgggggcagtgccagccgaagtctgccgttgcccaagaggccccggcgt
ggggctgcccctgagccggagcggacgcccgttgggcaggggtcctgggcccacccggac
aggactcgtggaccgagtgaccgtggtttctgtgtggtgtcacctgccagacccgccaaa
gaagccacctctttggagggtgcgctctctggcacgcgccactcccacccatccgtgggc
cgccagcaccacgcgggccccccatccacatcgcggccaccacgtccctgggacacgact
tgtcccccgatgtacgccgagaccaagcacttcctctactcctcaggcgacaaggagcag
ctgcggccttccttcctactcagctctctgaggcccagcctgactggcgctcggaggctg
gtggagaccatttttctgggttccaggccctggatgccagggactccccgcaggttgcgc
cgcctgccccagcgctactggcaaatgcggcccctgtttctggagctgcttgggaaccat
gtgcagtgcccctacggggtgctcctcaagacgcactgcccgctgcgggctgcagtcatc
ccagcagccggtgtctgtgcccgggagaagccccagggctctgtggcggcccccgaggag
gaggacacagacccccgtcgcctggtgcagctgctccgccagcacagcagcccctggcag
gtgtacggcttcgtgcgggcctgcctgcgccggctggtgcccccaggcctctggggctcc
aggcacaacgaacgccgcttcctcaggaacaccaagaagttcatctctctggggaagcat
gccaagctctcgctgcaggagctgacgtggaagatgagcgtgcgggactgcgcttggctg
cgcaggagcccaggggttggctgtgttccggccgcagagcaccgtctgcgtgaggagatc
ctggccaagttcctgcactggctgatgagcgtgtacgtcgtcgagctgctcaggtctttc
ttttatgtcacggagaccacgtttcagaagaacaggctctttttctaccggaagagtgtc
tggagcaagttgcaaagcattggaatcagacagcacttgaagagggtgcagctgcgggag
ctgtcagaaacagaggtcaggcagcatcgggaagccaggcccgccctgctgacgtccaga
ctccgcttcatccccaagcctgacgggctccggccaattgtgaacatggactacgtcgtg
ggagccagaacattccgcagagaaaagagggccgagcgtctcacctcgagggtgaaggca
ctgttcagcgtgctcaactacgagcgggcgcggcgccccagcctcctgggcgcctctgtg
ctgggcctggacgatatccacagggcctggcgcacctttgtgctgcgtgtgcgggcccag
gacccgccgcctgagctgtactttgtcaaggttgatgtgacaggcgcgtacgacaccatc
ccccaggacaggctcacggaggtcatcgccagcatcatcaaaccccagaacacatactgc
gtgcgtcggtatgctgtggtccagaaggccgcccatgggcacgtccgcaaggccttcaag
agccatgtctctaccttgacagacctccagccgtacatgcgacagttcgtggctcacctg
caggagaccagcccgctgagggatgctgtcctgctttcccagagctcctcctgaattgag
gccagcagtggcctcttcgacgtcttcctgcgcttcgtgtgccaccacgctgtgcgcatc
aggggcaagtcctacgtccagtccaggggatccccgcagggctccatcctgtccacactg
ctctgcagcctgtgcaacggcgacatggagaacaagctgtttgcggggattcggcgggac
gattactag

DBGET integrated database retrieval system