KEGG   Pongo abelii (Sumatran orangutan): 100939025
Entry
100939025         CDS       T01416                                 

Definition
(RefSeq) tyrosine-protein kinase receptor UFO isoform X1
  KO
K05115  AXL receptor tyrosine kinase [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100939025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100939025
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100939025
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  AXL family
   100939025
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase AAA_33 SPRY fn3 Ig_3 Ig_2 I-set ig V-set DUF4381 Pkinase_fungal AAA_18 APH C1-set
Other DBs
NCBI-GeneID: 100939025
NCBI-ProteinID: XP_024092261
LinkDB
Position
19
AA seq 1596 aa
MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQV
QGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVF
LGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPL
ATAPGYGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTE
LEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTLQASVPPHQLRLGSLH
PHTAYHIRVACTSSQGFSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPL
QGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP
VPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETR
YGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGK
TLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRL
IGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMADIASGM
EYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIES
LADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYA
LMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGDAMDSITRQNQF
YDTQVIKQENESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQS
RKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSS
GYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDS
CSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGK
WMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIR
GTVGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQ
RNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIV
ICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKL
VRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYDNRGPPGGNRGGFQNRGGGSG
GGGNYRGGFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQ
PPPPPSYSPARNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQSFGFFPSTFQPSYSQP
PYNQGGYSQGYTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYA
QQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ
NT seq 4791 nt   +upstreamnt  +downstreamnt
atggcgtggcggtgccccaggatgggcagggtcccactggcctggtgcttggcgctgtgc
ggctgggcatgcatggcccccaggggcacgcaggctgaagaaagtcccttcgtgggcaac
ccagggaatatcacaggtgcccggggactcacgggcacccttcggtgtcagctccaggtt
cagggagagccccccgaggtacactggcttcgggacggacagatcctggagctcgcggac
agcacccagacccaggtgcccctgggtgaggatgaacaggatgactggatagtggtcagc
cagctcagaatcacctccctgcagctttccgacacgggacagtaccagtgtttggtgttt
ctgggacatcagaccttcgtgtcccagcctggctacgttgggctggagggcttgccttac
ttcctggaggagcctgaggacaggactgtggccgccaacacccccttcaacctgagctgc
caagcccagggacccccagagcccgtggacctactctggctccaggatgctgtccccctg
gccacagctccaggttacggcccccagcgcagcctgcatgttccagggctgaacaagaca
tcctctttctcctgcgaagcccataacgccaagggggtcaccacatcccgcacagccacc
atcacagtgctcccccagcagccccgtaacctccacctggtctcccgccaacccacggag
ctggaggtggcttggactccaggcctgagcggcatctaccctctgacacactgcaccctg
caggctgtgctgtcagacgatgggatgggcatccaggcgggagaaccagaccccccagag
gagcccctcaccttgcaagcatccgtgcccccccatcagcttcggctgggcagcctccat
cctcacaccgcttatcacatccgcgtggcatgcaccagcagccagggcttctcatcctgg
acccactggcttcctgtggagacgccagagggagtgcccctgggcccccctgagaacatt
agtgccacgcggaatgggagccaggccttcgtgcattggcaggagccccgggcgcccctg
cagggtaccctgttagggtaccggctggcgtatcaaggccaggacaccccagaggtgcta
atggacatagggctaaggcaagaggtgaccctggagctgcagggggacgggtctgtgtcc
aatctgacagtgtgcgtggcagcctacactgctgctggggatggaccctggagcctccca
gtacccctggaggcctggcgcccagggcaagcacagccagtccaccagctggtgaaggaa
ccttcaactcctgccttctcgtggccctggtggtatgtactgctaggagcagtcgtggcc
gctgcctgtgtcctcatcttggctctcttccttgtccaccggcgaaagaaggagacccgt
tatggagaagtgtttgaaccaacagtggaaagaggtgaactggtagtcaggtaccgcgtg
cgcaagtcctacagtcgtcggaccactgaagctaccttgaacagcctgggcatcagtgaa
gagctgaaggagaagctgcgggatgtgatggtggaccggcacaaggtggccctggggaag
actctgggagagggagagtttggagctgtgatggaaggccagctcaaccaggacgactcc
atcctcaaggtggctgtgaagacgatgaagattgccatctgcacgaggtcagagctggag
gatttcctgagtgaagcggtctgcatgaaggaattcgaccatcccaacgtcatgaggctc
atcggtgtctgtttccagggttctgaaagagagagcttcccagcacctgtggtcatctta
cctttcatgaaacatggagacctacacagcttcctcctctattcccggctcggggaccag
ccagtgtatctgcccactcagatgctggtgaagttcatggcagacattgccagtggcatg
gagtatctgagtaccaagagattcatacaccgggacctggcggccaggaactgcatgctg
aatgagaacatgtccgtgtgtgtggcggacttcgggctctccaagaagatctacaatggg
gactactaccgccagggacgtatcgccaagatgccagtcaagtggattgccattgagagt
ctagctgaccgagtctacaccagcaagagcgatgtgtggtccttcggggtgacaatgtgg
gagattgccacaagaggccaaaccccatatccaggcgtggagaacagcgagatttatgac
tatctgcgccagggaaatcgcctgaagcagcctgcggactgtctggatggactgtatgcc
ttgatgtcgcggtgctgggagctaaatccccaggaccggccaagttttacagagctgcgg
gaagatttggagaacacactgaaggccttgcctcctgcccaggagcctgacgaaatcctc
tatgtcaacatggatgagggtggagatgccatggacagtattaccaggcagaaccaattc
tacgatacccaagtcatcaaacaagaaaacgagtcaggctacgagaggagaccactggaa
atggagcagcagcaggcctatcgcccagaaatgaagacagagatgaagcaaggagcaccc
accagcttcctcccgcctgaagcttctcaactcaagccagacaggcagcaattccagagt
cgaaagaggccttatgaagaaaaccggggacgggggtactttgagcaccgagaggatagg
aggggccgctctcctcagcctcctgctgaagaggatgaagatgactttgatgataccctt
gttgctattgacacttataactgcgacctccacttcaaggtggcccgagatcggagtagt
ggctatccgctcacaattgagggctttgcatacctgtggtcaggagcccgtgccagctat
ggggtcagaaggggccgtgtgtgcttcgagatgaagatcaatgaggaaatctctgtgaag
caccttccgtctacagagcctgacccccacgtggtccgtatcggctggtccctggactcc
tgcagcacccagctaggcgaagagcctttctcctatggctatggaggcactgggaagaag
tccaccaatagccggtttgaaaactacggagacaagtttgcagagaacgatgtgattggc
tgctttgcggactttgaatgtggaaatgacgtggaactgtcctttaccaagaatggaaag
tggatgggcattgctttccgaatccagaaggaagccttggggggtcaggccctctatcct
catgtcctggtgaagaattgcgcagtggagttcaacttcggacagagggcagagccctac
tgttctgtcctcccggggtttaccttcatccagcaccttccccttagtgagcgtatccgg
ggcaccgttggaccaaagagcaaggcagaatgtgagattctgatgatggtgggcctgcct
gctgctggcaagaccacatgggccatcaaacatgcagcctccaacccttccaagaagtac
aacatcctgggtaccaatgccatcatggataagatgcgggtgatgggcctacgccggcag
cggaactatgctggccgctgggacgtcctgatccagcaggccacccagtgcctcaaccgc
ctcatccagattgctgcccgcaagaaacgcaactatatcctagatcagacaaatgtttat
gggtcagcccagagacgaaaaatgagaccatttgaaggcttccagcgcaaagctattgta
atttgtcccactgacgaggacctaaaagaccgaacaataaagcgaaccgacgaggaaggg
aaggatgtcccagatcatgcggtcttagaaatgaaagccaacttcaccttgccagatgtt
ggggacttcctggatgaggttctgttcattgagctgcagcgggaggaagcagacaagcta
gtgaggcagtacaatgaggaaggccgcaaggctgggccaccccctgaaaagcgctttgac
aaccgaggtggtggtggcttccggggccgcgggggtggtggtggcttccagcgctacgac
aaccgaggaccccctggaggcaaccgtggcggcttccagaaccgagggggaggcagcggt
ggaggaggcaactatcgaggaggtttcaaccgcagtggaggtggtggctatagccagaac
cgctggggtaacaacaaccgggataacaacaactccaacaacagaggcagctacaaccgg
gctccccagcaacagccaccaccacagcagcctccgccaccacagccaccaccccagcag
ccaccgccaccacccagctacagtcctgctcggaaccccccaggggccagcacctacaat
aagaacagcaacatccctggctcaagcgccaataccagcacccccaccgtcagcagctac
agccctccacagagctttggcttttttccctccactttccagccgagttacagccagcca
ccctacaaccagggaggttacagccagggctacacagccccaccgcctccacctccacca
ccacctgcctacaactatgggagctacggcggttacaacccggccccctataccccaccg
ccaccccccaccgcacagacctaccctcagcccagctataaccagtatcagcagtatgcc
cagcagtggaaccagtactatcagaaccagggccagtggccgccatactacgggaactac
gactacgggagctactccgggaacacacagggtggcacaagtacacagtag

DBGET integrated database retrieval system