KEGG   Pongo abelii (Sumatran orangutan): 103888520
Entry
103888520         CDS       T01416                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X3
  KO
K09850  Ras association domain-containing protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04390  Hippo signaling pathway
pon04392  Hippo signaling pathway - multiple species
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05219  Bladder cancer
pon05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103888520 (RASSF1)
   04390 Hippo signaling pathway
    103888520 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    103888520 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103888520 (RASSF1)
   05206 MicroRNAs in cancer
    103888520 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    103888520 (RASSF1)
   05223 Non-small cell lung cancer
    103888520 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH
Other DBs
NCBI-GeneID: 103888520
NCBI-ProteinID: XP_009237250
UniProt: A0A2J8TH19
LinkDB
Position
3
AA seq 189 aa
MSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAV
KHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLL
AGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQ
EALHACPLG
NT seq 570 nt   +upstreamnt  +downstreamnt
atgagcttgaacaaggacggttcttacacaggcttcatcaaggttcagctgaagctggtg
cgccctgtctctgtgccctccagcaagaagccaccctccttgcaggatgcccggcggggc
ccaggacggggcacaagtgtcaggcgccgcacttccttttacctgcccaaggatgctgtc
aagcacctgcatgtgctgtcacgcacaagggcacgtgaagtcattgaggccctgctgcga
aagttcttggtggtggatgacccccgcaagtttgcactctttgagcgggctgagcgtcac
ggccaagtgtacttgcggaagctgttggatgatgagcagcccctgcggctgcggctcctg
gcagggcccagtgacaaggccctgagcttcgtcctgaaggaaaatgactctggggaggtg
aactgggacgccttcagcatgcctgaactacataacttcctgcgtatcctgcagcgggag
gaggaggagcacctccgccagatcctgcagaagtactcctattgccgccagaagatccaa
gaggccctgcacgcctgcccccttgggtga

DBGET integrated database retrieval system