KEGG   Pongo abelii (Sumatran orangutan): 103889518
Entry
103889518         CDS       T01416                                 

Gene name
BCAR1
Definition
(RefSeq) breast cancer anti-estrogen resistance protein 1 isoform X1
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04062  Chemokine signaling pathway
pon04510  Focal adhesion
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon04935  Growth hormone synthesis, secretion and action
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103889518 (BCAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103889518 (BCAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103889518 (BCAR1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103889518 (BCAR1)
   04062 Chemokine signaling pathway
    103889518 (BCAR1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103889518 (BCAR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103889518 (BCAR1)
   05100 Bacterial invasion of epithelial cells
    103889518 (BCAR1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103889518 (BCAR1)
SSDB
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2 Vinculin Caskin1-CID
Other DBs
NCBI-GeneID: 103889518
NCBI-ProteinID: XP_024088957
LinkDB
Position
16
AA seq 870 aa
MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPATQYTPMLPNTYQPQPDSVYLVPTP
SKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQ
VPPSAGMGHDIYQVPPSMDTRSWEGTKAPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHL
LAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPS
NHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAED
VYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERLLPPEVADGGVVDSGVYAVPPPAEREA
PVEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDL
AGSAGGTGSWRSPSEPQELLVQDLQAAVAAVQGAVQELLEFARSAVGNAAHTSDRALHAK
LSRQLQKMEDVHQTLVAHGQALDAGRGGSGATPEDLDRLVACSRAVPEDAKQLASFLHGN
ASLLFRRTKAPAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGW
MEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLA
NWTPAQPLAPGRTGSLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVA
HSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSP
SAAQDMVERVKELGHSTQQFRRVLGQLAAA
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgaaccacctgaacgtgctggccaaagccctctatgacaatgtggccgagtccccggat
gagctctccttccgcaagggcgacatcatgacggtgctggagcaggacacgcagggcctg
gacggctggtggctctgctcgctgcacgggcgccagggcatcgtgcctgggaaccgcctc
aagatcttggtgggcatgtatgataagaagccagcagggcctggccccggccctcccgcc
accccggcccagcctcagcctggcctccatgccccagcgcctccggccacccagtacacg
cccatgctccccaacacctaccagccccagcccgacagcgtctacctggtgcccactccc
agcaaggctcagcaaggcctctaccaagtcccgggtcccagccctcagttccagtcgccc
ccagccaagcagacatccaccttctcgaagcagacgccccatcacccgtttcctagcccg
gccacagacctgtaccaggtgcccccagggcctggaggccctgcccaggatatttaccag
gtgccaccttctgccgggatggggcatgacatctaccaggtccccccgtccatggacaca
cgcagctgggagggcacgaaggccccggcaaaggtggtggtgcccacccgcgtggggcag
ggctatgtatacgaggccgcccagccggagcaggacgagtacgacatcccgcgacacctg
ctggccccagggccacaggacatctatgatgtgcccccggttcgggggctgcttcccagc
cagtatggccaggaggtgtatgacacaccccccatggctgtcaagggtcccaatggccga
gacccattgctggaggtgtatgacgtgccccccagcgtggagaagggcctgccaccatcc
aaccaccacgcggtctacgacgttcctccatcagtgagcaaggatgtgcctgacggccca
ctgctgcgtgaggagacctacgacgtgccccctgccttcgccaaggccaagccctttgac
ccggcccgcaccccactggtcctggctgcgccccctccagactccccgccagccgaggat
gtgtatgacgtgcctcccccggctcctgacctctacgacgtgccccctggcttgcggcgg
cctggcccaggcaccctgtacgatgtgccccgtgaacggctgcttcctcctgaggtggct
gatggtggcgtggtcgacagtggtgtgtatgcggtgcctcccccagctgaacgtgaagcc
ccggtggagggcaagcgcctgtcggcctccagcaccggcagcacacgcagcagccagtcc
gcgtcctccttggaggtggcagggccgggccgggaacccctggagctggaagttgccgtg
gaggccctggcacggctgcagcagggtgtgagcgccaccgttgcccaccttctggacctg
gcaggcagcgccggtgggactgggagctggcgtagcccttctgagccacaggagctgctg
gtgcaggacctgcaggctgctgtggccgccgtccagggtgccgtccaagagctgttagag
tttgcccgcagcgccgtgggcaatgctgcccacacatctgaccgtgccctgcacgccaag
cttagccggcaactgcagaagatggaggacgtgcaccagacgctggtggcacatggtcag
gccctcgacgctggccggggaggctctggagccacccctgaggacctggaccggctggtg
gcctgctcgcgggctgtgcccgaggacgccaagcagctggcctccttcctgcacggcaat
gcctcattgctcttcagacggacgaaggcccctgccccggggcctgaggggggtggcacc
ctgcatcccaaccccactgacaagaccagcagcatccagtcacggcccctgccctcaccc
cctaagttcacctcccaggactcgccagatgggcagtacgagaacagcgaggggggctgg
atggaggactatgactacgtccacctgcaggggaaggaggagtttgagaagacccagaag
gagctgctggaaaagggcagcatcacgcggcagggcaagagccagctggagctgcagcag
ctgaagcagtttgaacgactggaacaggaggtgtcgcggcccatagaccacgacctggcc
aactggacaccagcccaacccctggctccggggcgaacaggcagcctggggccctcggac
cggcagctgctgctcttctacctagagcagtgtgaggccaacctgaccacactgaccaat
gccgtggacgccttcttcaccgccgtggccaccaaccagccgcccaagatcttcgtggca
cacagcaagttcgtcatcctcagcgcccacaagctggtgttcatcggggacacactgtca
cggcaggccaaggctgctgacgtgcgcagccaggtgacccactacagcaacctgctgtgc
gacctcctgcgcggcatcgtggccaccaccaaggctgctgccttgcagtacccatcgcct
tccgctgcccaggacatggtggagagggtcaaggagctgggccacagcacccagcagttc
cgccgcgtcctaggccagctggcagccgcctga

DBGET integrated database retrieval system