Pongo abelii (Sumatran orangutan): 103889825 Help Entry 103889825         CDS       T01416                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04010   MAPK signaling pathway pon04020   Calcium signaling pathway pon04022   cGMP-PKG signaling pathway pon04114   Oocyte meiosis pon04218   Cellular senescence pon04310   Wnt signaling pathway pon04360   Axon guidance pon04370   VEGF signaling pathway pon04380   Osteoclast differentiation pon04625   C-type lectin receptor signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon04658   Th1 and Th2 cell differentiation pon04659   Th17 cell differentiation pon04660   T cell receptor signaling pathway pon04662   B cell receptor signaling pathway pon04720   Long-term potentiation pon04724   Glutamatergic synapse pon04921   Oxytocin signaling pathway pon04922   Glucagon signaling pathway pon04924   Renin secretion pon05010   Alzheimer disease pon05014   Amyotrophic lateral sclerosis pon05020   Prion disease pon05022   Pathways of neurodegeneration - multiple diseases pon05031   Amphetamine addiction pon05152   Tuberculosis pon05163   Human cytomegalovirus infection pon05166   Human T-cell leukemia virus 1 infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05170   Human immunodeficiency virus 1 infection pon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103889825 (PPP3R1)    04310 Wnt signaling pathway     103889825 (PPP3R1)    04370 VEGF signaling pathway     103889825 (PPP3R1)    04020 Calcium signaling pathway     103889825 (PPP3R1)    04022 cGMP-PKG signaling pathway     103889825 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103889825 (PPP3R1)    04218 Cellular senescence     103889825 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103889825 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     103889825 (PPP3R1)    04660 T cell receptor signaling pathway     103889825 (PPP3R1)    04658 Th1 and Th2 cell differentiation     103889825 (PPP3R1)    04659 Th17 cell differentiation     103889825 (PPP3R1)    04662 B cell receptor signaling pathway     103889825 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     103889825 (PPP3R1)    04921 Oxytocin signaling pathway     103889825 (PPP3R1)    04924 Renin secretion     103889825 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     103889825 (PPP3R1)    04720 Long-term potentiation     103889825 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     103889825 (PPP3R1)    04380 Osteoclast differentiation     103889825 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103889825 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103889825 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     103889825 (PPP3R1)    05163 Human cytomegalovirus infection     103889825 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     103889825 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     103889825 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     103889825 (PPP3R1)    05014 Amyotrophic lateral sclerosis     103889825 (PPP3R1)    05020 Prion disease     103889825 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     103889825 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     103889825 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103889825 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pon01009]     103889825 (PPP3R1) Protein phosphatases and associated proteins [BR:pon01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103889825 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  103889825 NCBI-ProteinID:  XP_009235510 UniProt:  A0A2J8XBZ9 LinkDB All DBs Position 2A:40315048..40387974 Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcggatgaaatt aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat atattcgacacagatgggaatggagaagtagactttaaagaattcattgagggcgtctct cagttcagtgtcaaaggagataaggagcagaagttgaggtttgctttccgtatctatgac atggataaagatggctatatttccaatggggaactcttccaggtattgaagatgatggtg gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system