KEGG   Pongo abelii (Sumatran orangutan): 112128522Help
Entry
112128522         CDS       T01416                                 

Definition
(RefSeq) trypsin-2-like
Organism
pon  Pongo abelii (Sumatran orangutan)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 112128522
NCBI-ProteinID: XP_024105367
LinkDB All DBs
Position
7
AA seq 261 aa AA seqDB search
MHMRETNIFILKKGRSAPLVFHPPDAPTAAPFDDDDKIVGGYTCEENSVPYQVSLNSGYH
VCGGSLIREQWVVSAGHCYKSHIQVRLGEHNIEVLEGNEQFINAAKIICHPKYNSWTLHN
DILLIKLSTPAIISAHMSTISLPTTPPAAGTECLISGWGNTLSSGADYPDELQCLDAPVL
TQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGYAQKNRP
GVYTKVYNYVDWIKDTIAANS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgagagagacaaatatcttcatattgaagaaggggaggagtgcaccattggtt
ttccatcctccagatgcaccgactgctgccccctttgatgatgatgacaagatcgttggg
ggctacacctgtgaggagaattctgtcccctaccaggtgtccctgaattctgggtaccac
gtctgcggtggctccctcatcagggaacagtgggtggtgtcagcaggtcactgctacaag
tcccacatccaggtgagactgggagagcacaacattgaagtcctggaggggaatgaacag
ttcatcaatgcagccaagatcatctgccaccccaaatacaacagctggactctgcacaat
gacatcctgctgatcaagctctccacacctgccatcatcagtgcccacatgtctaccata
tctctgcccaccacccctccagctgctggcactgagtgcctcatctctggctggggcaac
actctgagctctggcgccgactacccagacgagctgcagtgcctggatgctcctgtgctg
acccaggctgagtgtgaagcctcctaccctggaaagattaccaacaacatgttctgtgtg
ggcttcctcgagggaggcaaggattcctgccagggtgactctggtggcccagtggtctgc
aatggacagctccaaggagttgtctcctggggctatggctatgcccagaagaacaggcct
ggagtctacaccaaggtctacaactatgtggactggattaaggacaccatagctgccaac
agctaa

DBGET integrated database retrieval system