KEGG   Pongo abelii (Sumatran orangutan): 112128523
Entry
112128523         CDS       T01416                                 

Definition
(RefSeq) uncharacterized protein LOC112128523
  KO
K10785  T-cell receptor beta chain V region
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04064  NF-kappa B signaling pathway
pon04514  Cell adhesion molecules
pon04612  Antigen processing and presentation
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04672  Intestinal immune network for IgA production
pon04940  Type I diabetes mellitus
pon05135  Yersinia infection
pon05142  Chagas disease
pon05144  Malaria
pon05150  Staphylococcus aureus infection
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05202  Transcriptional misregulation in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05310  Asthma
pon05320  Autoimmune thyroid disease
pon05321  Inflammatory bowel disease
pon05322  Systemic lupus erythematosus
pon05323  Rheumatoid arthritis
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112128523
   04015 Rap1 signaling pathway
    112128523
   04064 NF-kappa B signaling pathway
    112128523
   04020 Calcium signaling pathway
    112128523
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    112128523
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    112128523
   04660 T cell receptor signaling pathway
    112128523
   04658 Th1 and Th2 cell differentiation
    112128523
   04659 Th17 cell differentiation
    112128523
   04672 Intestinal immune network for IgA production
    112128523
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    112128523
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112128523
  09163 Immune disease
   05310 Asthma
    112128523
   05322 Systemic lupus erythematosus
    112128523
   05323 Rheumatoid arthritis
    112128523
   05320 Autoimmune thyroid disease
    112128523
   05321 Inflammatory bowel disease
    112128523
   05330 Allograft rejection
    112128523
   05332 Graft-versus-host disease
    112128523
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112128523
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112128523
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112128523
   05150 Staphylococcus aureus infection
    112128523
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112128523
   05170 Human immunodeficiency virus 1 infection
    112128523
   05162 Measles
    112128523
   05169 Epstein-Barr virus infection
    112128523
  09174 Infectious disease: parasitic
   05144 Malaria
    112128523
   05142 Chagas disease
    112128523
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 112128523
NCBI-ProteinID: XP_024105236
LinkDB
Position
7
AA seq 249 aa
LRGGALRLPGLRGRAQQGPDSALAGAARQPASTCRRRCNRSYCRAEAPQWPAPAAAPAAH
SPHLSLGPWVWISRKAETSRCRTVGARWPRQVKAEKWNRSCCIAWGPVNAGVTQTPKFQV
LKTGQSMTLQCAQDMNYDNMYWYRQDPGMGLKLIHYSVGEGTTDKGEVPDGYNVSRLNRQ
NFLLRLESAAPSQTSVYFCASSYSTALHGRLLSAHKRQGGSALLPHPRLRDALGRVLCTR
KLETPSSWV
NT seq 750 nt   +upstreamnt  +downstreamnt
ctgcgaggaggagctttacgacttcccggtcttcggggccgggcacagcaagggccagac
tctgcgctagcaggcgctgcgcgccaaccggccagcacctgtcgcagaaggtgcaaccga
tcgtactgtcgcgcagaagctcctcaatggccagcgccagctgcagccccggccgcccac
tcgcctcacctgagcctggggccgtgggtctggatttccaggaaagcggagacctcgagg
tgcaggactgtcggggcgaggtggccaaggcaggtcaaagctgaaaagtggaatcggagc
tgttgtattgcctggggtccagtgaatgctggtgtcactcagaccccaaaattccaggtc
ctgaagacaggacagagcatgacactgcagtgtgcccaggatatgaactatgacaacatg
tactggtatcgacaagacccaggcatggggctgaagctgattcattactcagttggtgag
ggtaccactgacaaaggagaagtccccgatggctacaatgtctccagattaaacagacag
aatttcctgctcaggctggagtcggctgctccctcccagacatctgtgtacttctgtgcc
agcagttactccacagcgctgcacggccgtctcctctctgcacataaaaggcagggaggc
tctgccctcctgccccaccccagactcagggatgccctgggcagagttctctgcaccagg
aaacttgaaaccccatcgtcatgggtctga

DBGET integrated database retrieval system