KEGG   Populus trichocarpa (black cottonwood): 112323401Help
Entry
112323401         CDS       T01077                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00052  Galactose metabolism
pop00500  Starch and sucrose metabolism
pop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    112323401
   00500 Starch and sucrose metabolism
    112323401
Enzymes [BR:pop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     112323401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 112323401
NCBI-ProteinID: XP_024437261
LinkDB All DBs
Position
11
AA seq 922 aa AA seqDB search
MPLTDHMTQKMEKERNKNSCRNTKATSPSQSNLQLLVLLLVCGVLLTSGKDVKEEVVGYG
YKIGSVNSGLAGKLLTADLSLIKRSSVYGNDIQHLNLIAEFETKNRLRVRITDSKDQRWE
IPQHIVPRQNHSPKNYLHYSPLNHRLLLDNNLLSDPNSDLLFTLHNTIPFGFSVTRKSSG
DVLFDTSTDMSNPDTFLVFKDQYIQLSSRLPIKRSSLYGLGEHTKSTFKLKPDDTFTLWN
ADLASANIDVNLYGSHPFYIDVRSASADGKVQAGTTHGVLLFNSNGMDIVYGGDRITYKV
IGGIIDLYFFAGPSPDMVIEQYTELIGRPAPMPYWSFGFHQCRYGYKNISDVEGVVAGYA
KARIPLEVMWTDIDYMDAYKDFTFHPVNFPLEKMKKFVNTLHQNGQKYVVILDPGISVNS
TYETYIRGMQADIFIKRNGIPYMGEVWPGKVYFPDFINPAGREFWGNEIKIFRELLPVDG
LWIDMNEISNFIDPTPTPFSTVDDPPYRINNAGIRRPINNKTVPATSLHFDVMKEYNVHN
LYGLLESKATNVGLINSTGKRPFVLSRSTFIGSGRYTAHWTGDNAATWDDLAYTIPSILN
FGLFGIPMVGADICGFSGNTNEELCRRWIQLGSFYPFARDHSSIDTTRQELYLWDSVAAS
ARKVLGLRYQLLPYFYTLMYEAHIKGTPIARPLFFSFPQDIKTYEVNSQFLIGKGVMVSP
VLKSGATSVDAYFPAGNWFDLFNYSNTVSVSPGKYIKLAAPADHINVHVHEGNILALQGE
AMTTEEARKTAFHLLVVLSSSGNSTGELFLDDGESVEMGGERKSWSLVKFHSEIVGDMAM
VRSNIINGEFAFSQKWMVSKVTFIGLKKTNGIKWYELQTSKETRSGNRRIRASLNNNGDF
DVLVMSGLSLFLGEEFKLNVKL
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaactgatcatatgacccaaaaaatggagaaagagaggaacaagaacagttgc
agaaacacaaaagcaacatctccatctcagagcaatcttcaacttctagtcttgctgttg
gtttgtggggtgctgctgactagtggaaaggatgtgaaagaagaagtggttggttatggc
tataaaattggctctgttaactctggtttagcaggcaagttgttgactgctgatcttagc
cttatcaagagatcttcagtctatggaaatgatatccaacatcttaatcttattgccgaa
tttgaaaccaagaaccgtttgagagtcagaataacagattccaaagaccaaagatgggag
attccgcaacacatcgttccccggcaaaaccactctccgaagaactacctgcattactct
ccattaaatcatcgactcctgctagataacaacctcctctctgaccccaactcagacctg
ctttttaccctgcacaacaccatcccttttggcttctctgtcacccgaaaatcctcaggt
gatgtcctcttcgacacgtccacggatatgtccaatcccgacactttcttggtctttaag
gatcagtatatccagctatcttccaggcttcctataaagagatcttctttatatggtctc
ggagagcacacaaagagcactttcaagttgaagcctgatgacacattcaccttgtggaat
gctgacctcgcaagtgctaatattgatgttaacctctatggttcccacccattttacatt
gatgtaagatcagcatcggctgatggcaaagtacaggcagggactactcatggtgtcctg
ctgtttaatagcaatggcatggacatagtttatggaggagataggataacttataaggtt
attggaggcattattgatttgtattttttcgctgggccatcgccagatatggtgatagag
cagtatacagagcttattggtcggccggccccaatgccatattggtcattcggatttcat
cagtgccgatacggttacaagaacatttctgatgttgaaggtgtggttgctggctatgca
aaagctcggatccctcttgaagttatgtggacagatattgattacatggatgcatacaag
gacttcacatttcatcctgttaactttcccctggaaaaaatgaagaaatttgtcaatacc
cttcaccaaaatggtcagaaatatgtggtcatcttggatcctggtatcagtgtgaactca
acgtatgaaacctacatcagaggaatgcaggctgatattttcattaaacgcaatgggatt
ccgtacatgggtgaagtgtggcctggaaaggtctatttcccggatttcataaatcctgct
ggccgagagttttggggtaatgagataaaaatatttcgagagcttctccctgtagacggt
ctctggattgacatgaacgagatatcgaatttcatagatccaacacccaccccattttct
accgttgatgatccaccctacaggattaacaatgctggtattcgacggcctattaataat
aaaactgttccagcaacatctctacactttgatgtcatgaaagagtacaacgttcataac
ctctatggccttttggaatcgaaagccacaaatgttggtctgatcaattcaactggtaaa
aggccattcgtactttctcgatcaactttcattggctctgggaggtatacagcacattgg
actggagataatgctgccacatgggatgacttggcctatactattccatcaattctgaat
ttcggactgtttgggattcctatggttggtgctgacatatgtggtttttcaggaaacaca
aatgaagagctttgtcggcgttggattcagctaggttccttttacccctttgcgagagat
cattcatcgatagacacaacacggcaggagctttatctctgggattctgttgcagcatca
gctaggaaggtgcttggccttcgatatcagctgcttccatatttctacacactaatgtat
gaggctcacattaaaggaaccccaatagcacgacctcttttcttttcattccctcaagac
atcaaaacttatgaagtcaactcacaatttctgatcggtaaaggtgtaatggtatcacca
gtattgaagtccggagctacctcagtcgatgcatactttcccgcgggaaactggtttgat
ctttttaactactctaatacggtttctgtaagtccaggaaagtacatcaaacttgctgca
cctgcagatcatataaacgtgcatgttcatgaaggaaatattctggccttgcaaggagaa
gccatgacaacggaagaagctcgaaaaacagcatttcatctattagtggttcttagcagc
agtggaaacagcacaggggaattattcttagatgatggggagagtgtggagatgggaggg
gagagaaagagttggagtttagtgaaatttcatagtgagattgtaggagatatggcaatg
gttagatcaaacatcataaatggagaatttgctttcagtcaaaagtggatggtgagcaaa
gtaacattcataggattgaaaaagactaatgggatcaagtggtatgagttgcagacttcc
aaggaaacaaggagtggaaatagaaggattagggcaagccttaataacaatggagatttt
gatgtcttggtgatgtcaggactttctttgttccttggagaggagttcaagttgaatgtg
aaattgtaa

DBGET integrated database retrieval system