KEGG   Populus trichocarpa (black cottonwood): 18095060Help
Entry
18095060          CDS       T01077                                 

Definition
(RefSeq) anthranilate synthase alpha subunit 2, chloroplastic isoform X1
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 18095060
NCBI-ProteinID: XP_024461379
LinkDB All DBs
Position
1
AA seq 198 aa AA seqDB search
MGEVSRFTFSLSDKCSLKPVDKTLAVTHRLLPLNLRLPATSPVNLNVRLSISSSSSRGCT
LKCSASTPDNQVARFQEASMNGNLIPLYRCIFSDHSTPVLAYRCLVREDDRDAPSFLFES
VEPGLDASTIGRYSVIGAQPSMEIVAKENMVTIMDHYEGRRREEIVEDPMEVPRRITEGW
KPQFIDELFNCILKVCST
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaagtctctcggtttaccttttctctctctgacaaatgctctttgaagcccgtg
gacaaaacccttgctgttactcatcgtctgcttccgctaaatctccgcttgcctgcaact
tcccccgttaatctcaacgttagactctcaatctcaagctcaagctcgcgtggctgtacg
ctcaaatgctcagcttcaacacctgataaccaggtagcaagatttcaagaagcttcaatg
aatgggaatttaattcctctataccgatgtatattctcagatcactcaactccagtgctt
gcttacagatgtctggttagggaagatgatagggatgctccaagctttctgtttgaatcg
gttgagcctggcttggatgcttcaacaattgggcgatatagtgtcataggagctcaacca
agtatggaaattgtggccaaagaaaacatggttacaataatggaccattatgaaggtcgt
cggagggaggagattgtggaggatccaatggaggttcctagaagaatcacggagggctgg
aaaccacaatttattgatgagctttttaattgcattttaaaagtttgttcaacttaa

DBGET integrated database retrieval system