KEGG   Populus trichocarpa (black cottonwood): 18095932Help
Entry
18095932          CDS       T01077                                 

Definition
(RefSeq) tryptophan synthase beta chain 1
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00260  Glycine, serine and threonine metabolism
pop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01230  Biosynthesis of amino acids
Module
pop_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    18095932
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    18095932
Enzymes [BR:pop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     18095932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 18095932
NCBI-ProteinID: XP_006370659
UniProt: U5GUH6
LinkDB All DBs
Position
1
AA seq 479 aa AA seqDB search
MAATTTTAASITTAAAASTAATITKSQSSSFLKPYSSSQLPFKFSKFTASRAPSRLAISC
TLAREAVVKMEDVVDSDPAQWRRPDSFGRFGKFGGKYVPETLIHALTELESAFHSLKDDP
EFKKELDGILKDYVGRENPLYFAERLTEHYKRPNGEGPHIYLKREDLNHTGAHKINNAIG
QVLLAKRLGKQRIIAETGAGQHGVATATVCARFGFPCVVYMGAQDMERQSLNVFRMRLLG
AEVRGVHSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPFPMMVREFHRVIGIETR
KQALEKWGGKPDVLVACVGGGSNAMGLFDDFIKDKDVRLIGVEAAGLGVDSGKHAATLTK
GEVGVLHGAMSYLLQDEDGQIIEPHSISAGLDYPGVGPEHSFLKDKGRAEYYSVTDEEAL
DAFKRLSRLEGIIPALETSHALAYLENLCPTLPDGTKVVLNCSGRGDKDVQTAIKYLQV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaccaccaccaccgccgcatccataaccacagcagcagcagcgtccaccgct
gcaaccatcaccaaatctcaatcttcctctttcctcaaaccctactcttcttcgcagtta
cccttcaaattttccaaatttacagcatctcgcgcaccttcaaggttggcaatttcttgc
actttggcccgagaggctgtggttaaaatggaggacgtggtggattctgacccggcccaa
tggcgacgacccgattcttttggccggtttggtaaatttggcgggaaatatgtacctgaa
acccttatccatgcactcactgagcttgaatctgctttccattccttaaaagatgaccct
gaatttaagaaagaactagatgggatattgaaagattatgttggaagggaaaaccctctt
tattttgctgagcggcttacagagcattataagcgtcctaatggtgaagggcctcatatt
tatctcaagagggaagatttaaaccacacaggtgctcataagattaataatgctattggc
caagtcttgctagcaaagcgtttgggaaaacagcggataattgctgaaactggagctggt
cagcatggagttgcaactgctaccgtttgtgcacggttcggttttccatgtgttgtttat
atgggcgcacaagatatggaaagacaatcgcttaatgttttcaggatgcgtcttcttggg
gctgaagtgagaggagttcattctggcactgcaaccttgaaagatgctacatcagaagct
atacgagattgggtgactaacgtggagacaacccattatattctgggatctgttgcaggg
ccacatccttttcccatgatggtgcgagagttccatagggttattggtatagaaacaaga
aaacaggcactggaaaaatggggtgggaagccagatgtgctggttgcatgtgttggtggt
ggttcaaacgcaatgggactctttgatgatttcattaaggacaaggatgttaggttgatt
ggcgtggaggctgcgggtttaggagtagatagtggcaagcatgctgccactctgaccaaa
ggagaagtgggggtgttgcatggagctatgagctatttgttacaagatgaagatggacaa
ataattgagcctcattctattagtgcagggttggactaccctggagttggacccgagcac
agcttcttgaaagataaaggacgtgctgaatactatagcgtcacagatgaagaagctttg
gatgcattcaagagattatcgcgattagagggcataatccctgctttggagacatcacat
gcactggcgtatttggagaatctctgccccactctcccagatggaacaaaggtggttctt
aactgcagtggcagaggggacaaagatgttcaaactgccataaagtatttgcaggtttaa

KEGG   Populus trichocarpa (black cottonwood): 7470939Help
Entry
7470939           CDS       T01077                                 

Definition
(RefSeq) tryptophan synthase beta chain 1
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00260  Glycine, serine and threonine metabolism
pop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01230  Biosynthesis of amino acids
Module
pop_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    7470939
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    7470939
Enzymes [BR:pop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     7470939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 7470939
NCBI-ProteinID: XP_002317583
UniProt: B9I0B9
LinkDB All DBs
Position
11
AA seq 472 aa AA seqDB search
MAATASITTAAAATTKPQSSSSSLLKPYSSSQLPIKFSKFSTSRAPSRFAISCTLAREAE
VKMEEVADSDPALWQRPDSFGRFGKYGGKYVPETLMYALTELESAFYSFKDDPEFKKEIN
GILKDYVGRENPLYFAERLTEHYKRPSGEGPHIYLKREDLNHTGAHKINNAVGQVLLAKR
LGKQRIIAETGAGQHGVATATVCARFGLPCVVYMGAQDMERQALNVFRMRLLGAEVRGVH
SGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPFPMMVREFHRVIGIETRKQALEKW
GGKPDVLVACVGGGSNAMGLFDEFIKDKDVRLIGVEAAGLGIDSGKHAATLTKGEVGVLH
GAMSYLLQDEDGQIIEPHSISAGLDYPGVGPEHSFLKDKGRAEYYSVTDQEALDAFKRLS
RLEGIIPALETSHALAYLEKLCPTLPDGTKVVLNCSGRGDKDVQTAIKYLEV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaccgcttccataaccaccgcagcagcagccaccaccaaacctcagtcctct
tcttcttctctcctcaagccctactcttcttcccaattacccattaaattctccaaattt
tcaacgtctcgcgcaccttcaagatttgcaatttcttgcactttggcccgagaggctgag
gttaaaatggaggaagtggcggattctgacccggccctatggcaacgacctgattctttt
ggtaggtttggtaaatatggcgggaaatatgtacctgagacccttatgtatgctctcact
gagcttgaatctgctttctattccttcaaggatgatcctgaatttaagaaagaaataaat
ggaattttgaaagattatgttggaagggaaaatcctctttattttgctgagcggcttaca
gagcattataaacgccctagtggtgaagggccacatatttatctcaagagggaagatctt
aaccacacaggtgctcataagattaacaatgctgttggccaagtcttacttgcaaagcgt
ttgggaaaacagcgcataattgctgaaactggagctggtcagcatggagttgcaactgct
acagtctgtgcgcggtttggtttgccatgtgttgtttatatgggcgcacaagatatggaa
agacaagcactaaatgttttcaggatgcgtcttcttggggctgaggtgagaggagttcat
tctggtactgcaacattgaaagatgctacatcagaagctatacgagattgggtgactaat
gtggagacaacccattatattttgggatctgttgctgggccacatccctttcccatgatg
gtgcgagagttccatagggttattggtatagaaacaagaaaacaagcattggaaaaatgg
ggtgggaagccagatgtgctggttgcatgtgttggtggcggttcaaatgcaatgggactc
tttgatgaatttattaaggacaaggatgtgaggttgatcggtgtggaggctgcaggttta
ggcatagatagcggcaagcacgctgccactctgaccaaaggagaagtaggggtgttgcat
ggagctatgagctatttgttacaagatgaagatggacaaataattgagcctcattcaatt
agtgcagggttggactaccctggagttggacctgagcacagtttcctgaaagataaagga
cgtgctgaatactatagtgtcacagatcaagaagcattggatgcattcaagagattatcg
cgattagagggcataattcctgctttggagacatcacatgcgctggcttatttggagaag
ctctgccccactctcccggatggaacaaaggttgttcttaactgcagcggcagaggggat
aaagatgttcaaactgccatcaagtatttggaggtttaa

KEGG   Populus trichocarpa (black cottonwood): 7485533Help
Entry
7485533           CDS       T01077                                 

Definition
(RefSeq) tryptophan synthase beta chain 1 isoform X1
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00260  Glycine, serine and threonine metabolism
pop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01230  Biosynthesis of amino acids
Module
pop_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    7485533
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    7485533
Enzymes [BR:pop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     7485533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP Macro_2
Motif
Other DBs
NCBI-GeneID: 7485533
NCBI-ProteinID: XP_002317204
UniProt: A0A3N7HDA6
LinkDB All DBs
Position
11
AA seq 461 aa AA seqDB search
MDKTCSIHTTFLNRQLHGGLCPATKHISLITTDKRRTGSGQTVLCSLVTPKTMNTRTLIE
RQVPREVSMPAKFGMFGGNFVPETLITSLKKLEAEFIYALQDTEFQEELATALRDYVGRE
TPLYFAQGLTNYYKNKDGEGAEIYLKREDLNHCGAHKMNNAVAQTMIAKRMGLKSVVAAT
GAGQHGVATAAACAKLSLSCTVFMGSDDMEKQSSNVLLMKLFGAQVKPVERSFKEASSEA
IREWASNLETSYYLTGTAVGPHPCPSMVCEFQSVIGKETRRQAMEKWGGKPDVLIACIGS
GSNAMGLFHEFIEDEDVRLIGVEAAGFGLDSGKHAATLSKGEVGVYHGAMSYLLEDEEGQ
IIRPHSIAVGLEYPGVSPQLSFLKDTERAEFYSATDKEAVDAYLRLSRLEGIIPSLEAAH
ALAYLDKVCPTLPNATKVIVNCSGRGDKDAGMVLDHRLEIN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggataagacttgcagtatccacacaactttcttgaatcgccaattacacggtggttta
tgtcctgccaccaagcacataagcctaataacaactgataagagaagaactggaagtggc
caaacagtactctgttcacttgttactcctaaaactatgaatacgaggacattgattgaa
agacaggttccccgtgaggtgtcaatgccagcaaaatttggcatgtttggagggaatttt
gtgcctgagaccctaatcactagtttgaagaagctggaagctgaattcatatatgcttta
caggatactgaatttcaggaggagcttgcgacggccctgagagactacgtaggaagggaa
acacctctgtattttgctcaaggattgacaaattactacaagaataaagatggagaaggg
gcagaaatttaccttaagagggaggatctcaatcattgtggagcacacaagatgaacaac
gctgttgcgcagacgatgattgccaaacgcatgggcctgaaaagtgttgtggcagccact
ggtgctggacagcatggtgttgcaactgcagctgcatgtgccaagctgtctttgtcttgc
actgtcttcatgggctctgatgatatggaaaaacaatcctcaaacgtactgttaatgaaa
ctatttggtgctcaggttaaacctgtggaaagaagttttaaagaagcaagctcagaggca
atcagggaatgggcaagtaacttagagacaagctactacctgacaggcacggccgtgggg
cctcatccatgtccaagcatggtctgtgaatttcagtctgtgattggaaaggagacaagg
aggcaagcaatggagaaatggggtggcaagccagatgtgttgattgcctgtatcgggagt
gggtctaatgcaatggggttgttccatgaattcatagaagatgaagatgtgaggttgata
ggagttgaggctgcagggtttggcttggatagtgggaaacatgctgcaactctgagtaaa
ggagaagttggggtctatcatggagccatgagctatttgttggaagatgaagaaggacaa
ataatacgaccacactcaatcgctgtggggctggaatatccaggggttagtccgcagctg
agctttcttaaggacacagaacgtgctgagttttattctgccacagataaagaggctgta
gatgcatacctaaggctaagcagattagaaggcataattccatccttggaggcagctcat
gcactggcatacctcgacaaagtttgtcctactttaccaaatgccaccaaagtcatagta
aattgtagcggtcgaggagataaagatgcaggaatggttcttgaccacagacttgagata
aattaa

DBGET integrated database retrieval system