KEGG   Populus trichocarpa (black cottonwood): 18096584Help
Entry
18096584          CDS       T01077                                 

Definition
(RefSeq) protein indeterminate-domain 2
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_jaz zf-met zf-C2H2_4 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 18096584
NCBI-ProteinID: XP_006386940
UniProt: U5GU12
LinkDB All DBs
Position
2
AA seq 501 aa AA seqDB search
MVGGENLSRITVSKASGEDTISNVSSFGNQGMPHSITVPPPKKKRNLPGMPDPDAEVVAL
SPKTLVATIRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEPRKRVYVCPESSCV
HHNPARALGDLTGIKKHFYRKHGEKKWKCERCSKKYAVQSDWKAHLKTCGTKEYKCDCGT
LFSRRDSFVTHRAFCDALAEESARAQTLAIMGREGNGCDIKRVGASPPPPPLTPSTSVVS
PGLSVQSSELAENPIGLSPPPIACASATSTSSTSSTSNVFATTFASSTATPAAIPQQASV
PSSFPNLFCGLARSDYPTTMPTPRAIEPPSLSLSPSFYLSNNTSSLFSTEQEHYHYTPSP
QPAMSATALLQKAAQMGATTSNPSFLRGLGLPRSTNQDSNCNKWDVKPENNTTVAAGLGL
GLPSSDVMMGSSSLFGNKPATLDLLGLGMDAASSALLNSYSGGFNVGAATAAAYGGGGGR
GTSEETWDGVPERKPYGSTGA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgggtggtgagaatttatccagaatcacagtatctaaagcttctggagaagacaca
attagcaatgtttcttcttttggtaaccaaggcatgccacactctattacagtgccacca
ccaaagaagaagcgaaatctccctggaatgccagatccagatgcagaagtcgttgcgtta
tcaccaaagactttagtagccacaatcagattcgtgtgtgagatctgtaacaagggcttt
caaagagaccagaacctccaacttcacagacgaggccataacttaccatggaagctaaag
caacgaaccaacaaagagccaaggaagcgtgtctatgtttgtccagagtcatcttgtgta
catcacaacccagctagagctcttggtgatcttactggcattaaaaagcacttctacaga
aagcatggtgagaaaaagtggaagtgtgagagatgttcgaagaaatatgccgtccagtct
gattggaaagctcacttgaaaacttgtggcactaaagagtataaatgtgattgtggcact
ttgttttcaaggagggatagttttgtaacacacagagcattttgcgatgcgttagcggag
gagagtgcaagggcgcaaaccctagcgataatgggaagggaagggaatggttgtgacatc
aagcgtgtgggtgcttcaccaccgcctccaccacttacgccgtctactagtgtggtgtct
ccgggtttatcagttcaaagctcagaattagcagaaaatccaattggactttcaccacca
ccaatagcatgtgcctcggctacaagcacaagctcaactagctcaaccagtaatgtattt
gcgactacatttgcctcttcgacagcaacaccagctgctatcccacaacaagcatcagta
ccatcctctttcccaaatctgttttgcggcttagctcgctctgattatcccactactatg
ccaacacctagagcgatagaacccccatcactctctctttcaccatctttttatctctcc
aacaatacttcgtctctcttcagcacagagcaagagcactaccattacacaccatctccg
caaccagccatgtctgccactgcattgcttcaaaaagcagcacaaatgggtgcaacgaca
tcaaacccatcatttctccgtggtttaggattaccccgttcaactaatcaagacagtaat
tgcaataaatgggatgtgaagccagagaacaacaccactgttgcagctggactcggcctt
gggcttccctccagtgatgttatgatgggttcatcttcattgtttggaaacaaaccagcg
acacttgaccttctcgggcttggcatggatgctgctagttctgctttgctaaattcctat
agtggtggctttaatgttggagcagccactgccgcagcatatggtggaggaggagggaga
gggacttctgaagaaacatgggatggtgtgcctgagaggaagccttatggatctacagga
gcttga

DBGET integrated database retrieval system