KEGG   Populus trichocarpa (black cottonwood): 18097814Help
Entry
18097814          CDS       T01077                                 

Definition
(RefSeq) uncharacterized protein LOC18097814
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1645
Motif
Other DBs
NCBI-GeneID: 18097814
NCBI-ProteinID: XP_024454479
LinkDB All DBs
Position
4
AA seq 371 aa AA seqDB search
MEMEVVMPVPPVDFNFDSTCSSPYMTAPSSPQRFGNFFLSAPTSPTRASSFYRELNDITL
STNSSSSMIPFDWEEKPGTPKSKNQREDNSRNDSDHDGFHEDFEFDFSGHLERASLSAEE
LFDGGKIKPLKPPPGYDSSVSSPRSPRSPISRTTKGFDPFQAAIEETRKREVKLQPNQQG
QAPNQRGRGRRNGGSSFSAGSIRKGSRSLSPLRVSDIMFDQEENSQNSNSIASTEITPKS
SYTSSILSAISFTSKRYKKWKLKDLLLFRSASEGSRTTSCNDELTRFSVMSKKEGTEDVK
NSSFRSTDSVGSARRRSGSISAHEVHYTVNRAVSEEMRRKTFLPYKQGLLGCLGFNAAHE
IARGVGSLTRG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggaagttgtgatgccagtgccacctgtggacttcaacttcgatagcacttgt
tcttctccttacatgacagctccttcaagtcctcaaagatttggaaacttcttcttgagt
gccccaacaagccccactcgtgcttcttctttctacagggagctaaatgatattactctt
tctacaaattcatcttcttcgatgatcccttttgactgggaagagaagcctggaactccc
aaatccaagaaccaaagagaagacaacagcaggaatgatagtgatcacgatggttttcat
gaagattttgagttcgattttagtggtcatttagaaagagcttctttatcggctgaagaa
ctctttgatggtggcaagatcaagcctttgaagccaccacctggctatgattcctcagtt
tcttctccaaggtctccaagatcaccaatatcaagaaccacaaagggatttgaccccttt
caagctgccattgaagagacgcgtaaaagagaggttaaactacaacctaatcaacaaggc
caagcacccaatcaacgtggaagaggcagaagaaacggtggctcttcattttcggctggt
tctatacgtaaaggaagcagatctttatctcctttaagagtttcagacatcatgtttgac
caagaagagaattcccagaattcaaattctattgcttcaacagaaatcacccccaaatca
tcttacacatcttctatcttatccgcgatatcattcacatcgaaaaggtacaagaaatgg
aagctaaaggacttattgctattcagaagtgcatcagaaggtagcagaacaacaagttgc
aatgatgagctaacaagattttcagtcatgtccaaaaaagaagggacagaggatgtcaag
aattctagctttcgatccacggatagcgtagggagtgccaggaggagatcagggtctata
tcagctcatgaggtgcattacacagtgaaccgggcagtttcagaggaaatgagaaggaaa
acgttcttgccatacaagcaaggtctactggggtgcttaggattcaatgctgcgcatgag
atcgctagaggtgttggttctttgacacgtggatga

DBGET integrated database retrieval system