KEGG   Populus trichocarpa (black cottonwood): 18098251Help
Entry
18098251          CDS       T01077                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pop00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18098251
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     18098251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 18098251
NCBI-ProteinID: XP_006384962
LinkDB All DBs
Position
4
AA seq 215 aa AA seqDB search
MQAAAMAAHAILTATPPTRHPLLSPLPPNHSSFHGVSLKLPRQSFSFSLAAKKQQPPFVV
AATKKAVAVLKGTSSVEGVVTLSQEDDGPTTVSVRITGLTPGPHGFHLHEFGDTTNGCMS
TGPHFNPKKLTHGAPEDEIRHAGDLGNIVANADGVAEATIVDSQIPLSGPNAVIGRALVV
HELEDDLGKGGHELSSTTGNAGGRLACGVVGLTPI
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagctgcaatggcagcccacgcaatcctcacagccactccaccaactcgtcac
cctcttctctccccacttcccccaaatcattcctcattccatggcgtctcccttaagctc
ccgcgtcaatctttttccttctctctggctgccaagaagcagcaacctccttttgttgtt
gctgctaccaagaaagctgttgctgtccttaaaggcacttccagtgttgaaggcgtcgtc
actttgtcccaggaagacgatggtcctacaacagtgagtgttcgtattactgggcttacc
ccagggcctcatgggttccacctgcatgaatttggtgacacaacaaatggatgcatgtca
acaggaccgcattttaatcctaaaaaattgacacatggtgctcctgaggatgaaatccgt
catgcgggtgacctgggaaacatagttgctaatgccgatggagtggcagaggcaacaata
gtggatagccagataccactgagtggtccaaatgcagtgattggaagagcacttgtggtc
catgagctagaagatgaccttggaaagggtgggcatgaactaagctcaaccactgggaat
gcaggcggtagattggcatgtggagttgttggtttgactccaatataa

DBGET integrated database retrieval system