KEGG   Populus trichocarpa (black cottonwood): 18098296Help
Entry
18098296          CDS       T01077                                 

Definition
(RefSeq) zinc finger transcription factor YY1
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_aberr zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 18098296
NCBI-ProteinID: XP_006385011
UniProt: B9N0B2
LinkDB All DBs
Position
4
AA seq 378 aa AA seqDB search
MEAHHHHHQFTHNIFERRPIIRSKTPAVKWFKEWVPQDVVATGGRCSLFKWVTENQLNAL
KEKAKEPQAPEPEPEPTTEVLFLCSFEGCGKTFIDAGALRKHSHIHGERQYVCHYEGCGK
KFLDSSKLKRHFLIHTGERDFICPHEGCGKAFSLDFNLRSHMKTHSQENYHICPYPECGK
RYAHEYKLKNHIGSHHEKNPTPEVVKYATPPERIPKNAKTPPGVYGSASSDRPYICPYEG
CEKDYIHEYKLKLHLRREHPGHMADENAENATPNADNELDEASDQDAYGGKRVNGKSQKQ
SRSKPNLKMPPVKIRQRKGSSPSPATLNVVKKPWTIKDETYEEEEDSEETEEEDRDNAED
GWRYGGNEDDDEETEDED
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaggctcatcatcatcatcatcagttcactcacaatatatttgagagacgccccatt
atcagatcaaagactcctgctgttaaatggttcaaagaatgggtgcctcaagatgtggtg
gcaactggtggaaggtgttctcttttcaaatgggtaacagaaaaccaattaaatgccttg
aaagagaaggcaaaagagccccaagcaccagagccagaaccagagcctactactgaggtt
cttttcctttgcagttttgaagggtgtggtaagacctttatcgatgctggtgctttgaga
aagcattctcatatacatggagagagacaatatgtttgtcactatgagggatgcggaaag
aaatttttggatagttccaagttgaaaagacactttttaattcatacaggggaaagagat
ttcatatgtcctcatgaaggctgtggtaaggcattctccttggatttcaacctgagatct
cacatgaaaacacattcacaagaaaactatcatatctgtccatacccagaatgtggaaag
agatatgctcatgaatacaagctgaagaaccacattggttctcatcatgaaaagaatccg
actccagaagtggtgaaatatgctacacctccagagaggatacctaagaatgccaagact
cctccaggggtttatggctctgcatcatcagatcgaccatacatttgcccttatgaaggg
tgtgaaaaggattacatccatgaatacaagctcaaactccatctgagaagagagcatcct
ggccacatggcagatgagaatgctgagaatgcaacacctaatgctgacaatgaattggat
gaagccagtgatcaagatgcttatggtggaaagcgtgtgaatgggaaaagtcagaaacag
agcaggtccaagccaaacttgaagatgcctcctgtaaaaatcagacaacggaaaggctca
agtccatcacctgccacattgaatgtagtgaaaaaaccttggacaattaaggatgagact
tatgaagaagaagaagacagtgaagaaaccgaggaagaggatcgtgacaatgcagaggat
ggatggaggtatggaggaaacgaggatgatgatgaagagacggaggatgaagactag

DBGET integrated database retrieval system