KEGG   Populus trichocarpa (black cottonwood): 18099284Help
Entry
18099284          CDS       T01077                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00020  Citrate cycle (TCA cycle)
pop00190  Oxidative phosphorylation
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    18099284
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    18099284
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     18099284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 18099284
NCBI-ProteinID: XP_024458093
LinkDB All DBs
Position
5
AA seq 636 aa AA seqDB search
MWRCVARGLRLPSSSSSTKILSNDSFRFHSTRFFSADSTGGGSSYTVVDHTYDAVVVGAG
GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCA
CAADRTGHALLHTLYGQAMRHNTQFFVEYFALDLLMNNDGSCQGVIALNMEDGTLHRFCA
ASTILATGGYGRAYFSATSAHTCTGDGNAMVARAGVPLEDLEFVQFHPTGIYGAGCLITE
GSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLN
HLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTLKGDDP
DAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAKIHRPGEKQKPLEKDA
GERTIAWLDKLRNSNGSLSTSHIRLNMQRTMQNNAAVFRTQETLEEGCHLIDKAWESFHD
VKVKDRSLIWNSDLIETLELENLLINACVTMHSAEARKESRGAHAREDFTKRDDENWMKH
TLGYWENEKVRLDYRPVHMNTLDDEIEPFPPKARVY
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtggctcgtggccttcgccttccttcttcttcttcctcgacgaagata
ttatctaatgactctttcagatttcacagtaccagatttttctctgccgattctactggg
gggggatcctcatacacggttgtggatcatacttatgatgcggttgtagtaggagcaggc
ggtgcgggcttgagagctgctattggactttcagagcatggattcaatacagcttgcatt
accaagctttttcccactcgatcgcacactgttgcggctcagggtggtattaatgctgct
ctgggaaatatgaccgaggatgattggagatggcacatgtatgacactgtcaagggaagt
gactggttaggtgatcaggatgccatccaatacatgtgtagggaggcaccaaaagcagtc
attgaacttgagaactacggattacctttttctcgaacagaagatggaaaaatttatcag
cgtgcatttgggggtcaaagtttggattttgggaaaggtgggcaggcatatcgttgtgcg
tgtgctgctgacagaactgggcatgctcttttgcatactctctatggccaagctatgaga
cacaatacacaattttttgtggaatattttgctttggatctattaatgaataatgatggt
agctgccaaggagtgattgcactgaatatggaagatgggacattgcatcgcttctgtgct
gcttcaacaattctggctacagggggatatggtagagcatacttttcagcaacctcagca
catacatgcactggagatggcaatgcaatggttgcccgggccggggttccacttgaggat
ttggagtttgttcagtttcatcctacaggcatatacggagcggggtgccttattacagaa
ggatctcgtggtgaaggtggtattcttaggaacagtgaaggtgagcgatttatggaaagg
tatgcacctacagccaaggatcttgcttcaagagatgtcgtttcaagatccatgaccatg
gaaattcgggagggtcgtggtgtaggacctttgaaggaccatatatatctgcacttgaat
cacttgcccccagatgtgctcaaggagaggcttcctggtatctctgaaactgctgccatt
tttgctggtgtggatgttacaaaggaacccatccctgtcctaccgaccgtgcattataat
atgggtgggattcccacaaattaccatggagaggtagttacccttaaaggtgacgatcca
gatgcagttgttcctggattaatggctgctggagaggcagcctgtgcttcagttcatggt
gccaaccggcttggtgcaaattctcttcttgacattgttgtgtttggccgagcttgtgca
aatagagtagccaaaatccatagaccaggtgagaaacagaaacctttggaaaaggatgct
ggagagaggactattgcatggctggataaactaagaaattcaaatggatcactttcaact
tcacacattcggttaaatatgcagaggacaatgcagaacaatgctgctgttttccgcaca
caagaaacattggaagagggttgtcacttgattgataaggcatgggaaagctttcatgat
gtgaaagtgaaagatcggagtttaatatggaactctgacttaattgagacactggagttg
gaaaaccttttgataaatgcctgtgtaactatgcactctgctgaagcccggaaagagagc
aggggagcacatgcccgtgaagatttcaccaaaagagatgatgagaactggatgaagcat
actctgggatattgggagaatgagaaggtccgactggattacaggccagttcacatgaac
acgttagatgatgagattgagccattcccgccgaaggctcgtgtttattga

DBGET integrated database retrieval system