KEGG   Populus trichocarpa (black cottonwood): 18101414Help
Entry
18101414          CDS       T01077                                 

Definition
(RefSeq) anthranilate synthase alpha subunit 1, chloroplastic
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pop01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    18101414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chorismate_bind
Motif
Other DBs
NCBI-GeneID: 18101414
NCBI-ProteinID: XP_006379626
UniProt: U5G1S0
LinkDB All DBs
Position
8
AA seq 128 aa AA seqDB search
MMITPCWDALRAALPVGTVSGAPKVKAMELIDQMEVSRRGPYSGGLGGVSFTGDMDIALA
LRTMVFPTETQYNTMYSYKDAQLRREWIAGAGIVADSVPEDEHRECQNKVAGLARAIDLA
ELTFVNKS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcacaccttgctgggatgccctccgtgctgcattgcctgtcggaactgtcagt
ggggcaccaaaggtaaaggcaatggaattgattgaccaaatggaggtgtcgaggcgtggt
ccttacagtggaggattaggaggggtttccttcactggtgatatggacattgcactggct
cttaggaccatggtattcccaacggaaactcaatacaacacaatgtactcgtataaggat
gctcagctacgccgtgaatggattgctggtgctggtatagttgcagacagtgtacccgaa
gacgagcaccgtgagtgccagaacaaagttgctgggcttgctcgcgccatcgacttggct
gagttaacttttgttaacaagtcatga

DBGET integrated database retrieval system