KEGG   Populus trichocarpa (black cottonwood): 18101815Help
Entry
18101815          CDS       T01077                                 

Definition
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00071  Fatty acid degradation
pop00592  alpha-Linolenic acid metabolism
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01212  Fatty acid metabolism
Module
pop_M00087  beta-Oxidation
pop_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    18101815
   00592 alpha-Linolenic acid metabolism
    18101815
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     18101815
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     18101815
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     18101815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH
Motif
Other DBs
NCBI-GeneID: 18101815
NCBI-ProteinID: XP_006380154
UniProt: B9N038
LinkDB All DBs
Position
8
AA seq 726 aa AA seqDB search
MKGSRTKGTTTIEVGADGVALITLINPPVNALSSDVLNSLKDSYEQALRRDDVKAIVITG
AKGKFSGGADISSFEEVQEGKVNEPKPDFIFSEVLGDTLEAAKKPSVAAIDGLALGGGLE
VAMACHARISTPTAQLSLPELQLGLIPGFGGTQRLPRLVGITKALEMMLTSKPVKGEEAH
ALGLVDAVVSPNELVSTARQWALDIFECRRPWIASLYKTEKLDSLGEAREIFKFARAQAQ
KRAPNLLHPIVCINVVEHGIVSGPRAGLYKEFESFQELVRSDISKSLVHIFFALHGTTKV
PGITDLGFVPRLVKKVAVLGGGLMGSGIATALILSNYPVILKEVNDQFLQAGIGRVRANL
QSRVKKGKMTQEKFEKTMSLLKGSLDYESFKDVDMVIEAVIENVSLKQQIFSDLEKYCPP
HCILASNTSTIDLNLIGKQTKSQDRIIGAHFFSPAHVMPLLEIVRTKQTSPQVIVDLLDV
GKKIRKTPVVVGNCTGFAVNRMFFPYTQAAIFLVEHGVDLYQIDRVISKFGMPMGPFRLA
DLVGFGVAIATGMQFVENFPERTYKSMLLPLMQEDKRGGETTCKGFYLYDDRRKAKPDPE
LRKYIEKARSISGVAVDPKLAKLPEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASL
MGMGFPPYRGGIMFWADSFGSKYIYSRLEEWSKTYGEFFEPCAFLAERGAKGAPLSSPVE
QAKSRL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaagcaggaccaagggaacaaccactattgaagtcggagctgatggggtggct
ttaatcaccctcatcaatcctcctgtcaatgcactctcttctgatgtgttgaacagcttg
aaggacagttatgagcaagctttaagaagagatgatgtgaaggcaatcgttataacaggt
gcgaagggaaagttctctggtggtgctgacatttcttcttttgaggaagttcaagaggga
aaagtgaatgaaccaaaacctgattttatattctccgaggttctcggtgacactttagaa
gctgcaaaaaaaccttcagttgctgcaattgatggccttgccttaggtggaggactagag
gttgcaatggcttgccatgctcgcatctcaacccctactgctcaattaagcctacctgaa
cttcaacttggactaattcctggatttggaggaacacagagacttccacgtcttgtgggt
atcacaaaggcccttgaaatgatgctgacatcaaaaccagtaaagggtgaggaagcacat
gccctgggccttgtggatgctgttgtttcgccaaatgagttggtaagtactgcacgtcag
tgggcccttgatatcttcgaatgtaggagaccatggattgctagcctttacaagactgaa
aaattagattcccttggcgaggcaagggaaatattcaagtttgctagagcacaagcccag
aaacgagctcctaatcttttacatcctatagtttgcatcaacgttgttgaacatggcata
gtttctggtccacgtgctggactctacaaggagtttgaaagtttccaagaacttgtgcgt
tctgacatcagcaagagcttggtccacatcttctttgctctgcatggaacaaccaaggtt
ccaggaattactgatctgggctttgtacctagactagtgaagaaggttgctgtgcttggt
ggaggattaatgggttcgggaatagcaactgcattaattctcagtaattatccagtgatc
ctgaaagaagtaaatgaccaattcttgcaggctggtattggtagagtcagagccaatctc
caaagtcgtgtcaagaaaggaaaaatgacacaagaaaagtttgaaaaaaccatgtctctt
ctcaagggttctcttgattatgaaagttttaaagacgtggacatggtcatagaggctgtg
attgaaaatgtttctttgaagcaacaaattttttctgatctagaaaaatattgcccacca
cattgcatacttgccagcaacacttccacaatcgacttgaacttgattggaaagcagacc
aagtcgcaagataggattattggagcccatttctttagtccggctcatgttatgccactt
ttggaaattgtccgtaccaagcagacatctcctcaagtaattgtggatttattagatgtt
gggaagaaaataaggaagactccagtcgtggttggaaattgcacaggctttgctgtcaac
aggatgttctttccttacacccaagctgctatttttcttgttgaacatggtgtggatctt
tatcaaattgacagggtgatcagcaaatttggaatgccaatgggcccattcaggttggct
gacctggttgggtttggcgtcgcaattgcaactggcatgcaatttgttgagaatttccca
gagcgaacctataaatctatgcttctcccactaatgcaagaggataagagaggaggtgaa
actacttgcaaaggattctatttgtatgatgataggcgcaaagctaagccagatcctgaa
ttaaggaaatacattgagaaagcaagaagcatttctggtgttgccgttgatcccaagctt
gcaaaattaccagagaaggacattgtggagatgatattcttcccagtagtgaatgaggct
tgccgagtctttgccgaaggcattgcagtcaaagctgctgaccttgacattgcatctctt
atgggaatgggttttccaccttacagggggggcattatgttttgggctgattcttttgga
tccaaatacatttactcaagattggaggaatggtcaaagacgtatggagaattctttgag
ccatgtgccttcttggctgaacgaggtgccaagggtgctcctctgagttctccggttgag
caagcgaagtctcggctgtaa

DBGET integrated database retrieval system