KEGG   Populus trichocarpa (black cottonwood): 18102538Help
Entry
18102538          CDS       T01077                                 

Definition
(RefSeq) protein SHOOT GRAVITROPISM 5 isoform X1
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-MYST zf-C2H2_6 zinc_ribbon_4 zf-C2H2_4 zf-H2C2_2 Spc7 zf-met
Motif
Other DBs
NCBI-GeneID: 18102538
NCBI-ProteinID: XP_006378427
UniProt: A9PFF0
LinkDB All DBs
Position
10
AA seq 422 aa AA seqDB search
MLDSITTSTAPSPSSDPFTSSLDNGLTNKRKRKPAGTPDPDAEVVSLSPRTLLESDRYVC
EICSQGFQRDQNLQMHRRRHKVPWKLLKRETQEVKKRVYVCPEPSCLHHDPCHALGDLVG
IKKHFRRKHSNHKQWVCEKCSKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRVESFIEHQ
DACTVRRAQPELQALQPAACSSRTASSTSPSSDANFSIVPLPGIPMSKATEPVYFYSDRN
DASTSQQEHNLELQLLPSSSTHFPQNPDEGYATNLKLSIGSSDSLKKNEQFKAIMDPSGP
KRTYEPTLEAAKLEEFANEQLRLAITEKAYAEEARQHAKRQIEMAELEFANAKRIRQQAQ
AELEKAQVLREQATKKISSTIMQVTCQACKLQFKLSTAAASADETSLAMSYMSSATTEGD
GE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgttagacagcatcaccacttcaactgctccttctccttcctctgatcccttcacgagt
tccttagataatgggctcaccaataaaagaaaaagaaaacctgcaggcacaccagatcca
gatgcagaggttgtatctctatcgcccaggaccttactagaatcagacagatatgtctgt
gagatctgtagccaagggtttcaaagagaccagaacctacaaatgcataggagaaggcac
aaggtaccatggaaattactgaaaagggagacacaagaagtgaagaagagagtttatgta
tgccctgaaccaagctgcttacaccatgacccatgccatgctttaggagatcttgttggc
ataaagaagcactttagaaggaagcacagtaatcacaagcagtgggtttgtgagaagtgc
tctaaaggttatgctgttcagtctgattacaaagctcacctcaaaacttgtggtacaaga
ggtcattcttgtgactgtggccgtgtattttccagggtggagagtttcatcgagcaccaa
gatgcttgcacagtaaggcgagcccagcctgaactacaggcattgcagccggcggcctgc
tcatccagaaccgcctcaagcaccagcccttcaagtgatgccaattttagcatagttccg
ttaccagggataccaatgtcaaaggcaaccgaaccagtttacttttactcggatagaaat
gatgcatctactagtcagcaagaacacaatcttgaacttcagctcctaccatcttcaagc
actcacttcccacaaaatcctgacgagggttacgctacaaatttgaagctttcaataggg
tcaagtgatagtttaaaaaaaaacgaacaattcaaggccattatggatccaagtggcccg
aaaagaacttatgaacctacactagaagcagcaaagttagaggagtttgctaatgaacag
ttgaggttggctataactgaaaaggcctatgctgaggaggctagacaacatgcaaagaga
caaattgagatggctgaactggaatttgcaaatgcgaagaggataaggcaacaagctcaa
gctgagcttgaaaaggctcaagttttgagagagcaagctacaaagaagattagctctacc
attatgcaagtcacctgccaagcttgcaagctacaattcaaactatcaacggctgctgca
tcggcagacgaaacctcccttgctatgagttacatgtcctcagcaactactgaaggggac
ggggagtga

DBGET integrated database retrieval system