KEGG   Populus trichocarpa (black cottonwood): 18102757Help
Entry
18102757          CDS       T01077                                 

Definition
(RefSeq) probable lysine-specific demethylase ELF6
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC JmjN zf-C2H2 zf-H2C2_2
Motif
Other DBs
NCBI-GeneID: 18102757
NCBI-ProteinID: XP_006378772
LinkDB All DBs
Position
10
AA seq 1627 aa AA seqDB search
MGNVEIPEWLKGLPLAPEFRPTDTEFADPIAYISKIEKEASAFGICKIIPPLPKPSKRYV
FSNLNKALSKCPELGDDVDLSNGVLRDGGNDGENRAVFTTRQQELGQSAKKAKGVDKENP
QSGVHQQVWQSGEVYTLEQFESKSKAFARSLLGMIKEVNPLAVEALFWKAASEKPIYVEY
ANDVPGSGFGEPEGHFRYFQRRRRKRASYQSYRRSREIPVCRENDMDGVKNSHNDDVTVK
NEPSMCLKMTPRSSMASATPSAEDSLKSSKQKSVAASNDMEGTAGWKLSNSPWNLQVIAR
SPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHIGSPKTWYAVPGDY
VFAFEEVIRTKAYGGNIDRLAALSLLGEKTTLLSPEAIISSGIPCCRLVQNPGEFVVTFP
RAYHVGFSHGFNCGEAANFGTPQWLKVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFVSR
VPRSLLPGPRSSRLRDRQREERELSVKKAFLEDMLKENDVLSAFLEKNSTCHVVIWNPDL
LPCASKESQLLSITSTITTTSNENASHVHSDLNSNSNENDLFKEMSLYMETLNDLYMEDD
LSCDFQVDSGTLACVACGILGFPFMSVVQPSERAFIELTPGDYLLAQEEPGVTRSDNVQP
SSNPDISVKGSIPDDHAPVSDLSVSLKDLPAPTGWNTSRKFLRPRIFCLEHGVQIEELLQ
SKGGANMLIICHSDYQKIKAHAFAIAEEIENPFNYNEVPLEAASQENLNLINLAIDDEDH
HECGEDWTSKLGINLRYCVKIRKNSPSKKVQHALALGGLFSDRSLSSDFLNIKWQSRRSR
SRIKFNQPVNCKPCKIMETNKDELLGNKSDGLTDKKEKKLIHYTRRKYKVKIDYSTNGLQ
RCSRRCLAEEVSGTSGDDPDKHAEQTTVIYPCNIGITGSGSAAFGFSPIEDSEMLHEVQV
LEAASGLTLNSAPSQIAGSILTATMAVESVAGQIEDQLLEESNTERNICNVKASGSCEIE
HEINASGGTSERQDFCTAKCCSPFDTAANERFEMQIEDQIMGNVNIMSETCDLVSEGQQR
ILYDDDDASMHEVSDLANSASLHVSHLPVAQMANVVVENSSINNEVSPPVTLDNEVQREI
ETKSRTNGDQCSSSDDTLMNQPPTTPDERCDHEQETCAAENKMQQETEITNGSNEELVLS
DVISGPNIVPMDESSEFHREPHAAVNLCNGVAFESGEQLVFLTTNDSNKELTSCSGTQME
INPSTASPEFSKLNRQDSAENDLCSGSTLGTVVPLEIPTTDISTVEEFAPNSATKNQVLA
EASREICVIQDLYSCMDLEPEVEQEIQSNDGVIGDSVAQKMHESSSSINEDRPVSTCVIL
VNQPTPSSVKKCCDIEYKSCGGESVVKCNEVCSSQEIESIESTVVDFRSNAGKGRKRKGE
VEQPTENKLNSNGFIRSPCEGLRPRAGKDATCKSEVDVGKSAEENPVTKRSRKPSDASVP
RPKRKEITKRSHKCNLEGCRMSFETKTELQLHKRNRCTYDGCGKKFRSHKYAIVHQRVHE
DDRPLKCPWKGCSMSFKWAWARIEHIRVHTGEKPYLCKVEGCGLSFRFVSDFSRHRRKTG
HYSNTPA
NT seq 4884 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgtggaaatacccgaatggttaaaagggttgcctttagcacctgagtttagg
ccaactgatactgaatttgcagacccaattgcttacatatcgaaaattgagaaggaagct
agtgcttttgggatttgtaagatcatacctccattgcctaaaccttcgaaaagatatgtt
ttcagtaacttgaataaggcgctgtctaagtgtccggaattgggtgatgatgtggacttg
tcgaatggtgttttaagggatggtggtaatgatggggagaatagggcggtgtttactact
aggcagcaggagttagggcaaagtgcgaagaaagcaaaaggggtggataaggagaatccc
caatcgggtgttcatcagcaagtttggcaaagtggcgaggtttatacgttggaacagttt
gagtctaagtctaaggcttttgcgaggagtttgttgggtatgattaaggaggttaatcca
ttggctgtggaggcattgttttggaaggcagcttctgagaagcctatctatgtggaatat
gcaaatgatgtgcctggttcaggatttggggaacccgaaggtcactttcgatattttcaa
agacggaggaggaagagggcatcgtatcagtcttatcgccggagtagagaaatccctgtt
tgccgggaaaatgatatggatggtgtaaagaattcccataatgatgatgttactgttaag
aatgagccaagcatgtgtttgaagatgacaccgaggtcatctatggcatccgcaactcct
tctgcagaggatagtttgaagtcttctaagcaaaagagtgtagctgcatctaatgatatg
gaaggtactgcaggctggaagctttcaaatagcccttggaatctgcaagtgattgctcgc
tcacctggctcacttactcgttttatgccagatgatatcccaggtgttacttctcctatg
gtctatattggtatgttgtttagttggtttgcttggcatgttgaggatcatgagcttcac
agcatgaattttctacatattggttctccaaagacttggtatgctgtccctggagattat
gtatttgcttttgaggaagttatacgcactaaggcttatggtggcaatattgatcgacta
gctgccctgagtctgttgggtgagaagacaacccttctgtctcctgaagcaattatttcc
tcaggcattccttgttgtaggttagtacagaatcctggtgaatttgttgtgacttttcca
agggcctaccatgtaggattcagccatggttttaactgtggggaagctgccaactttgga
actccacaatggcttaaagtagctaaggaagctgcagtccgtagagctgccatgaactat
cttcccatgctttctcatcagcagcttctatacctgctgaccatgtcttttgtttccaga
gtgccaagatccttactaccaggccctcggagttctcgtcttagagatcgtcagagagaa
gaaagagagttgtcagtaaagaaggcttttctagaagacatgttaaaggaaaatgatgtt
ttatctgcttttcttgagaaaaattccacttgtcatgtggtgatatggaaccctgatttg
cttccttgtgcaagtaaagagtctcaattactcagcataacttctactatcactactaca
tcaaatgaaaatgcttcccatgttcattctgacttaaatagtaatagtaatgagaatgat
ctgtttaaggagatgagcttgtatatggaaactctcaatgatttatacatggaagatgat
ttatcgtgtgattttcaagttgattcggggacattagcatgtgtggcatgtggaatcctt
ggttttccatttatgtccgttgtacaaccttcggagagagcatttatagaacttacacct
ggggattatcttttggctcaagaagagccaggagttacaagaagcgataatgttcagccc
tcttcaaaccctgatatctctgttaaaggctccattccagatgatcatgctcctgtgagt
gatctttctgtgtccctgaaggatcttccagcgccaacagggtggaacacttctcgtaag
tttttgagacctcgtattttctgcctggagcatggtgtccaaattgaggagctgttacag
tctaaaggtggagcaaacatgcttataatttgccattcagactatcaaaagataaaagct
catgcttttgccatcgcggaggaaattgagaatcctttcaattataacgaggttcctttg
gaagctgcatcccaagaaaatctgaacttgataaatcttgcaatcgatgatgaagatcat
catgaatgtggagaagattggacatcgaaactgggtatcaacttacggtattgtgtaaag
atcagaaagaactctccatctaagaaagttcaacatgcattagcattgggaggattattc
tctgacagaagtctcagttcagatttcttaaacatcaaatggcaatctagaagatctcgg
tcaagaatcaagttcaatcagcctgtcaattgtaaaccatgcaagattatggaaacaaac
aaagatgaattgttggggaataagtcagatggtctcactgacaaaaaagaaaaaaaactt
attcattacacaagaaggaagtacaaggtaaaaatagattattccacaaatgggcttcaa
agatgctctagaaggtgcttggcagaagaagtttcaggaactagtggtgatgatcctgat
aagcatgctgaacaaactactgtgatttacccttgcaacattgggattaccggaagtggt
tctgcagcatttggtttttctcccattgaagattctgaaatgctgcatgaggtccaggtg
ctggaagcagctagtggtttgaccttgaattctgctccttcacaaattgcaggttcaatt
ctcactgctaccatggctgtcgaaagtgttgcggggcagattgaggatcaattgctggag
gaatcaaacaccgagaggaacatttgtaatgtaaaagccagtggtagttgtgagatagag
catgagataaatgcctcaggaggaaccagtgaaagacaggatttttgcaccgcaaaatgc
tgcagtccatttgacactgcagctaatgaaagatttgaaatgcagatagaggatcaaatt
atgggaaatgtcaacattatgagtgagacttgtgatttggtttcagaaggacaacaaagg
atcctgtatgatgatgatgatgcttcaatgcatgaggtttctgatcttgctaactcagca
agtttacatgtttctcacctccctgtcgcacaaatggcgaatgtagttgtggagaattca
tccattaacaatgaggtttctcctcctgtgactttggataatgaagtgcagagagagatc
gagactaaaagcagaaccaatggtgaccaatgctcttcaagtgatgacacactgatgaat
caacctcctaccacaccggatgaaagatgtgatcatgagcaagagacctgtgcagcagaa
aataagatgcagcaagaaactgaaatcacaaatgggagtaatgaggaactggttctaagt
gatgttattagtgggcctaatattgttcctatggatgaaagttctgaatttcatagagag
ccgcatgctgcagtcaacttgtgcaatggtgtggcttttgaaagtggggagcagctggtt
tttctgactacaaatgattctaacaaggaacttacttcatgttctggtacacaaatggaa
ataaatccatctactgcgtcaccagaattctctaaactaaataggcaggactctgctgaa
aatgacttgtgcagtggttctactttaggcactgttgtaccactagaaattccaactaca
gacataagcactgtggaggaatttgcccctaattctgcaaccaaaaaccaagtacttgct
gaagcttcaagagagatctgtgttattcaagacttgtattcttgtatggatttagaacct
gaagtagagcaggaaattcagtccaatgatggggtgattggagacagtgtagcacagaaa
atgcacgagagttcaagttctattaacgaagacagacctgtgtctacttgtgttattctg
gtaaatcagcctactccttcctcagttaaaaaatgttgtgacattgaatacaaatcttgt
ggtggagaaagtgtggtaaaatgcaatgaagtttgttcatctcaggagattgagagcatt
gagtccactgtggtagactttagatcaaatgctggaaagggcagaaaaagaaagggtgaa
gtggagcagccaacagaaaacaagctcaatagcaatggcttcatcaggagtccatgcgaa
ggattgagaccaagggcagggaaagatgcaacatgtaagagtgaggttgatgttggaaaa
tcagctgaggagaatccagtaacaaagaggtcaaggaaaccttctgatgcttcagttcct
cgcccaaaaaggaaagaaatcacaaagagatctcacaagtgtaatctagaaggttgccgc
atgagttttgagacaaagacagagttacagttgcacaagcgcaaccgatgcacatatgat
ggatgtggtaagaagtttcgttcccacaaatatgcaatagttcatcaacgtgttcatgaa
gatgatagaccgctcaagtgtccatggaagggttgctccatgtcgttcaagtgggcatgg
gccaggattgagcatattcgggtgcacactggtgagaagccatacctgtgcaaggttgaa
ggctgtggcctttctttcaggtttgtatcagacttcagtcggcacaggaggaaaacagga
cactattcaaacacacctgcatga

DBGET integrated database retrieval system