KEGG   Populus trichocarpa (black cottonwood): 18109687Help
Entry
18109687          CDS       T01077                                 

Definition
(RefSeq) BES1/BZR1 homolog protein 4 isoform X1
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: BES1_N Cornifin
Motif
Other DBs
NCBI-GeneID: 18109687
NCBI-ProteinID: XP_024456812
LinkDB All DBs
Position
1
AA seq 328 aa AA seqDB search
MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG
WTVEPDGTTFRKGCKPVERMDILGVSATTSPCSSYHPSPCASYNPSPGSSSFPSPASSSY
AANANMDCNSLIPWLKNLSSASSSASSSKFPHLYIHGGSISAPVTPPLSSPTARTARIKA
DWEDQSIRPGWGGQHYSFLPSSTPPSPGRQIVPDPEWFRGVRMPQGGPTSPTFSLVASNP
FGFKEEAFGGGGSNGGSRMWTPGQSGTCSPAIAAGSDHTADIPMAEISDEFAFRCNATGL
VKPWEGERIHEECGSDDLELTLGNSRTR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaggtacgagactaccaacatggaaagaaagagagaacaacaagagaagagaa
aggagaagaagagccattgcagcaaagatattttctgggctaagaatgtatggcaactac
aagcttccaaaacattgtgacaataatgaagtccttaaagccctctgcaatgaggctggc
tggaccgtcgagcccgatggcactactttccgtaagggatgcaaacctgtagaacgcatg
gacattcttggtgtttctgcaacaacaagtccatgctcctcgtaccaccctagcccttgt
gcttcctacaacccaagtcctggatcctcttcctttcccagtccagcttcatcctcatac
gctgctaatgccaatatggattgcaattccctcataccatggctcaaaaacctctcatcg
gcatcttcatcagcttcctcctctaagtttcctcatctctacatccatggtggctccata
agtgctcctgttactcctcctttgagctctccaacagctcgaaccgctcgaataaaagct
gactgggaagaccaatctatccgcccaggctggggtgggcagcactactccttcttgcca
tcttcaactccaccgagtcctggccgccaaattgttcccgatccagaatggtttaggggg
gttcgaatgccacaaggcggtccaacgtctcccacatttagcctagttgcctccaaccca
tttggcttcaaggaagaggcttttggtggtggtggatccaatggtggatcccgcatgtgg
actccaggtcaaagtggtacatgttcacctgccattgcagctggctctgatcatacagct
gatattcccatggccgagatttcagatgagtttgcatttcgatgtaatgctactggtcta
gtgaagccatgggaaggagagaggatccatgaagaatgtggatcagacgatctagagcta
acgcttgggaactcaagaaccaggtga

DBGET integrated database retrieval system