KEGG   Populus trichocarpa (black cottonwood): 18110158Help
Entry
18110158          CDS       T01077                                 

Definition
(RefSeq) uncharacterized protein LOC18110158 isoform X1
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF668 DUF3475
Motif
Other DBs
NCBI-GeneID: 18110158
NCBI-ProteinID: XP_024448852
LinkDB All DBs
Position
Unknown
AA seq 660 aa AA seqDB search
MGGICSKKSNGNNKKANPYGKTNGNGVVSYENKQHISSTQQVKESKEKKELQAANLKQES
FLNSKNDIGDEFYDGIPRYPSSSIKSRSIRRQAAVAKVSEVSSRLSRVGSVGLGKAVEVL
DTLGSSMTNLNPQTFTSSVATKGNELGILAFEVANTVVKGSNLMQSLSVRSVRHLKEEVL
PSEGVQNLISKDMDELLRIVAADKREELKIFSGEVVRFGNRCKDPQWHNLDRYFEKISRD
RNPRRQLQEEAESIMELLMILVQFTAELYHELQILDRMEHECQRREGSAAANQRGESLAM
LKAEIKSQKKRIRNVKKKSLWSRSLEEVMEKLVDIIHFLILEIGNAFGSGDDSVQDEESV
SNNPRLGPAGLSLHYANVVMQIDNLVARSSSMPPNGKDTLYQSLPPGVKSALRSKLQSFN
VKDELTITEIKDTMEKTLQWLVPLSTNTAKVHHGFGWVGEWASSGSEANRKPAAGAADII
QIETLHHADKEKTEAYILEQLLWLHHLVSKTKSVSSGVSIKSHAKSAIGTQGQKSNQKQE
QESPNAADLPHAVTSNAPPPTTTEDQKILQDASEENQIEENSKSQGINSVDTKLREDGGL
STTNNNSPRRKSEDSATVKSVPSVLPISDIGIDKEEELDKIDRVDVLRYKGKPGLVTAKT
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgggagggatttgttcaaagaaatccaatggtaacaacaagaaagccaatccatatgga
aagactaatgggaatggtgttgtttcttatgaaaacaagcaacatatttcaagtactcaa
caagtgaaggaaagtaaagagaagaaggaattgcaagcggcaaatttaaagcaggaatca
tttttgaattctaaaaatgatattggggatgagttttatgatgggattcctagatatcca
tcatcatcaatcaaatcaagatcaattcgcagacaagcagctgttgccaaggtttcggag
gttagttcacgtttaagtagagttggcagtgttggactggggaaagcagtggaggtcctg
gacacgctagggagtagcatgacaaatttaaacccccagactttcacctctagtgtagcg
actaagggcaatgaacttggaattctagcttttgaggtagctaacacggttgtcaagggt
tccaaccttatgcaatctctttctgtacgaagtgtaagacatttgaaggaagaggtgctt
ccttcagaaggtgtgcaaaatctgatatcaaaagatatggacgagcttttgaggattgtt
gcagctgacaagagagaagagctgaaaatattttcaggagaagtggttcgtttcggaaat
cgatgtaaagatcctcaatggcacaacttggaccgttattttgagaaaattagccgagat
cgtaatcctcgtaggcaattgcaggaggaggcagaatccataatggaacttttaatgatt
ctggttcagtttacagctgagctataccatgaattgcaaattttagacagaatggaacat
gaatgtcaacgtagggagggtagtgcagcagctaatcagagaggagaaagccttgcgatg
ttgaaggcagaaataaaaagccaaaaaaagcgaatacgaaacgtaaagaagaaatcactt
tggtctagaagtttggaagaggtgatggagaagcttgtagatatcatccatttcttaatc
ctcgagatcggcaatgcctttggtagtggtgatgattccgtacaagatgaagaatctgtt
agcaataatccaagattgggacctgccggtctttctttacattatgcaaatgtagttatg
caaattgataatcttgtggcaagatcgagctccatgcctccaaatggtaaggacacattg
taccagagcttgccacctggtgtaaaatcagctctacgttccaaactgcaatcgtttaat
gtcaaagatgagcttaccatcacagaaattaaagatacgatggagaagacactgcagtgg
ctggttccactgtccactaacacagccaaagtgcatcacggttttggttgggttggagag
tgggctagttccgggtctgaggccaacagaaaacctgctgctggagcagctgatataatc
cagattgaaacactccaccatgcggacaaggagaaaacagaagcctatattcttgaacaa
ctattatggcttcaccatcttgtcagcaaaaccaagagtgtttctagtggtgttagcata
aaatctcatgccaagtctgcaattggcacacagggtcagaagtcgaatcagaaacaagag
caagagtcacccaatgcagctgacttgcctcacgctgtaacgtccaatgcaccaccacca
acaactaccgaagaccaaaaaatattgcaggatgcaagtgaggaaaaccagatagaagaa
aatagtaagagccagggcattaactcagtggataccaagttgagagaagatggtgggctg
agtacgactaacaacaattcccctagaaggaaaagcgaggactcagctactgtcaaaagt
gttccttctgtgcttcccatcagtgatattggtattgacaaggaggaagaattggataag
attgacagagttgatgtgctcagatacaagggaaagcctggacttgttactgccaaaact
tga

DBGET integrated database retrieval system