KEGG   Populus trichocarpa (black cottonwood): 18111193Help
Entry
18111193          CDS       T01077                                 

Definition
(RefSeq) zinc finger transcription factor YY1 isoform X1
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_aberr zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 18111193
NCBI-ProteinID: XP_006389565
UniProt: U7E1K0
LinkDB All DBs
Position
3
AA seq 375 aa AA seqDB search
MEAHHHHQFTHNIFERRPIIKSKTPAVKWFKEWVPQDVVATGGKCSLFKWVAENQLNVLK
EKAKEPPAPEPEPEPTTEVLFLCSFEGCGKTFIDAGALRKHSHIHGERQYVCHYEGCGKK
FLDSSKLKRHFLIHTGERDFVCPHEGCGKAFSLDFNLRSHMKTHSQENYHICPYSECGKR
YAHEYKLKNHIASHHEKNPTPDVVRYATPPERILKNPKPPSGVYGSASSDRPYICPYEGC
EKDYIHEYKLKLHLRREHPDHMADENAENANSNADNEMDEASDQDAYGGKRVNGKSQKHS
RPKPNLKTPPVKIRQRKGSSSSPATLNVVKKPWPVKDDTYEEDSEETEEEDHDNAEDGWR
YGGNEDDDEETEDED
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaggctcatcaccatcatcagttcactcacaatatattcgagagacgccccattatc
aaatcaaagactcctgctgttaaatggttcaaagaatgggtgcctcaagatgtggtggca
acaggtggaaagtgttctcttttcaaatgggttgcagagaatcaattgaatgtcttgaaa
gaaaaggcaaaagagcccccggcaccggagccagaaccagagcctactactgaagttctt
ttcctttgcagttttgaagggtgtggaaagacctttatcgatgcaggtgctttgaggaag
cattctcatatccatggagagagacaatatgtttgtcactatgagggatgtggaaagaaa
tttttagatagttccaagttgaaaagacacttcttaattcatactggtgaaagagatttt
gtatgtcctcatgaaggctgtggtaaggcattctccttggacttcaacttgagatctcac
atgaaaacacattcacaagaaaactatcatatctgtccatactcagaatgtggaaagaga
tatgctcatgaatacaagctgaagaaccacatcgcatctcatcatgaaaagaatccgaca
ccggatgtggtgagatatgctacacctccagagaggatactgaaaaatcccaagcctcct
tctggggtttatggctctgcttcatcagatagaccatacatttgcccttacgaagggtgt
gaaaaggactacatccatgaatacaagctcaaacttcatctgagaagagagcatcctgac
cacatggcagatgagaatgctgagaatgcaaattctaatgctgataatgagatggatgaa
gccagtgatcaagatgcttatggtggaaagcgtgtgaatgggaaaagtcagaaacacagc
aggcccaagccaaacttgaagacgcctcctgtaaaaatcagacaacggaaaggttcaagt
tcatcccctgccacattaaatgtagtgaaaaaaccttggccagttaaggatgacacttac
gaagaagacagtgaagaaaccgaggaagaggatcacgacaatgcagaggatggatggaga
tatggagggaacgaggacgatgacgaagagacagaggatgaagactag

DBGET integrated database retrieval system