KEGG   Populus trichocarpa (black cottonwood): 7456898Help
Entry
7456898           CDS       T01077                                 

Definition
(RefSeq) anthranilate phosphoribosyltransferase, chloroplastic isoform X1
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01230  Biosynthesis of amino acids
Module
pop_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    7456898
Enzymes [BR:pop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     7456898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N GlutR_dimer FANCI_S2
Motif
Other DBs
NCBI-GeneID: 7456898
NCBI-ProteinID: XP_024437667
LinkDB All DBs
Position
12
AA seq 419 aa AA seqDB search
MAASLSAASLSLISQRPKSPVLDFEDKNCCFCARPGYYAKQSHIIRNVIGGRSRKGASLV
SASLPTISENSASTVPAFNELIESLINKVDLSESEAEASLDYLLDDASEALISAFLVLLR
AKGETFEEVVGLARAMFKHARKVEGLVDAVDIVGTGGDGANTVNISTGASILAAACGAKV
AKQGNRSSSSACGSADVLEELGVVIDLDPEGVSRCVNEAGIGFMMSPKYHPAMKIVSPVR
KKLKIKTIFNILGPMLNPASVPFAVVGVFHEDLVLKMAKALQRFGMKRALVVHSEGLDEM
SPIGPGVVFEVNPEKISKFSFDPLDFGIPRCTLFDLQGGGPDYNADALRRVLSGEKGAIA
DAIILNAAAALFVSGRSSSLAEGVVLARETQLSGKALNTLNLWIEMSNKVKEDSVAQVA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgagtttgtctgcagcttctctttctttgatatctcagcggcccaaatcgccc
gttctcgattttgaagacaaaaactgctgcttctgtgctcgaccaggttactacgcgaag
caaagtcacataatcagaaatgtaataggaggtagaagcagaaaaggtgcgagtctggtg
tctgcttcactgcctactatttctgaaaattcagcttccaccgtacctgcattcaatgag
ttgattgaatctttgattaataaggtggatttgtcagaatctgaggccgaagcatcatta
gattatttacttgatgatgctagtgaggccttgatcagtgctttcttggtattgctcaga
gccaagggagagacttttgaagaggttgttggattggcaagggcaatgttcaagcatgcc
aggaaggtggaagggttggtggatgctgtggatattgttggaacgggtggtgatggtgca
aacaccgttaacatttctacaggagcgtcaatacttgcagctgcttgtggtgctaaagta
gccaagcaagggaatagatcaagttcttcagcatgtggaagtgctgacgtattggaagaa
cttggggtagtaattgacctggacccagagggggtatcaagatgtgtgaatgaagcagga
atcggcttcatgatgtcaccaaaataccatcctgcaatgaagattgtcagccctgtaagg
aagaaattgaaaatcaaaaccatcttcaacatactgggtcctatgctgaatcctgcaagt
gttccctttgctgttgttggtgtattccatgaagatttggtgctgaaaatggccaaagca
ttgcaacgctttggcatgaagagagcattggttgttcattcagagggcttggatgaaatg
agtcccattggacctggagtagtctttgaagtcaaccccgaaaagatatcaaaattttca
ttcgatccattggactttggcattccgcgctgtacactatttgacttgcaaggtggaggt
cccgattataatgcagatgctttaagacgtgtattgtcgggggagaaaggcgccattgct
gatgccattatcctaaacgcagcagctgctctctttgtcagtggccgctctagtagctta
gcggagggagtagttttggctcgagagacgcaattatcagggaaagctcttaatacactt
aatttatggatagagatgtctaataaagtgaaagaagattctgttgctcaggtcgcctga

DBGET integrated database retrieval system