KEGG   Populus trichocarpa (black cottonwood): 7458251Help
Entry
7458251           CDS       T01077                                 

Definition
(RefSeq) RNA exonuclease 4 isoform X1
  KO
K18327  RNA exonuclease 4 [EC:3.1.-.-]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pop03009]
    7458251
Enzymes [BR:pop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     7458251
Ribosome biogenesis [BR:pop03009]
 Eukaryotic type
  90S particles
   RNase
    7458251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_T zf-C2H2 CAAP1 zf-C2H2_6 zf-C2H2_jaz zf-C2H2_2 zf-met
Motif
Other DBs
NCBI-GeneID: 7458251
NCBI-ProteinID: XP_006386818
LinkDB All DBs
Position
2
AA seq 357 aa AA seqDB search
MDAEADPPTRSRTERHKCFACYKQFKKKEHLVEHMKISYHTPHQPKCGVCQKHCKSFESL
RNHLTGPLSRAGCSRTFSAQGCDLCLKLYDSPSSLGKHREICHLSAPASLGTKILPFAGS
VDVKYTTKGAKAIAINCGLVGGGTDGSLDLCARVCLVDEDENIIFHTYVQPQSAVTDYRY
EITGLTEEHLRNSKSHKEVQDRILEILYNGESARRLMSDSGKARLLVGHDLKRGLDCLRI
NYPGHLLRDTAKYRPLLKTNLVSHSLKYLTKTYLGYDIQTGEHDPYVDCVSVMRLYKRMR
AQDHQGKGIGTPDSDSGFESQKAEELENMTPDELYQISKSDYKCWCLDSSIAAGLNS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgaagctgacccaccaacaagatcgcgaaccgaaaggcacaagtgctttgca
tgctacaagcaattcaagaaaaaagaacatcttgttgagcacatgaagatttcctaccac
acacctcatcagcctaaatgtggggtctgccaaaagcactgcaaatcttttgaatctctg
aggaatcaccttactggcccattatcaagggctggttgttcgaggactttctctgcccaa
ggttgtgatctctgcttgaaactctatgatagccccagttctcttggcaagcatagagaa
atatgccacctatctgctcctgcttcccttggaacaaagatattgccttttgcaggatct
gttgatgtaaagtacaccaccaaaggtgccaaagccattgctatcaactgtgggttggtt
ggtggtggaaccgatggatcacttgacctttgcgcaagggtgtgtctggttgatgaagat
gaaaatattattttccatacatatgttcaacctcaaagtgctgttaccgattacagatac
gaaataactggattaactgaagagcatctaagaaattcgaagtctcataaggaagtacaa
gacagaattctggaaattttgtacaatggagaatctgctaggagactaatgtcagacagt
ggaaaggctagactgcttgtgggtcatgacttgaagcgtggtttggattgcttgaggata
aactatcctggtcatttgctgagggatactgcaaaataccgaccattgttgaaaactaac
ctggttagccactcgctcaagtacctcaccaaaacatatcttgggtatgatatccagaca
ggggaacatgatccatacgtagattgtgtttctgttatgagactgtacaagagaatgcgt
gctcaagatcatcaaggtaaaggaattggaactccagattcagacagcggttttgagtcc
cagaaagcagaggaactcgagaacatgaccccagatgagctataccagatctcaaagtca
gactacaaatgttggtgtctagattcaagtatagcagcagggcttaacagttga

DBGET integrated database retrieval system