KEGG   Populus trichocarpa (black cottonwood): 7458655Help
Entry
7458655           CDS       T01077                                 

Definition
(RefSeq) aminodeoxychorismate synthase, chloroplastic isoform X1
  KO
K13950  para-aminobenzoate synthetase [EC:2.6.1.85]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    7458655
Enzymes [BR:pop01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     7458655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chorismate_bind GATase Anth_synt_I_N Peptidase_C26
Motif
Other DBs
NCBI-GeneID: 7458655
NCBI-ProteinID: XP_024465331
LinkDB All DBs
Position
10
AA seq 916 aa AA seqDB search
MALCSSTSLELKNPFIEGTKGKIATSKSFLRVGYVAKNEKSCCCNGRKVAVSSHLMPGHL
EGSFMEKKRLEEPSQKMDFVRTLLIDNYDSYTYNIYQELSVVNGVPPVVIQNDEWTWEDA
CHYLYEKRAFDNIVISPGPGSPTCAADIGICLRLLLECRDIPILGVCLGHQALGYVNGAR
IVHASEPVHGRLSEIEHNGSRLFDNIPSGRKSGFKVVRYHSLIIDSEALPKELIPTAWTS
SSTHSFLESPNSGLNLDACKNQIRPSTSSDTFSTGSHNGASWSFSHPGRMQGGKVLMGIM
HSTRPHYGLQFHPESIATCHGRQIFENFREITEDYWQRLRPRSTFINERNVHYTACMQVH
VASQLFRVPRIGSLVHKEDAQPFKEAFRRSQLLGNANVNCLSISSALKFPESSINVRHLK
LKWRKFDKLAARVGGARNIFNELFGVCKAENTFWLDSSSVEKKRARFSFMGGKDGPLWRQ
MTFRLSDQSDMDFKGGGYLSIKDTQGSTESMFLEKGFLDFLNQELLSFTYDEEDFEELPF
DFHGGYIGYFGYSLKVECGMLSNRHKSTTPDACFFFADNFVVIDHLNDNVYILSLHEEST
TSIPWLDDTENKLLCLEASTTRKLGEQASPTATFSPYKAGFLGEKSREQYIKDVSKCLEY
IKDGESYELCLTSQMRKTVGEIDSLGLYLHLREKNPAPYAAWLNFSNEDLCICCSSPERF
LCLDRNGILEAKPIKGTIARGVTLEEDEELKLKLQYSEKDQAENLMIVDLLRNDLGRVCE
PGSVHVPHLMEVESYATVHTMVSTIRGKKRSNVSAVDCVRAAFPGGSMTGAPKLRSMELL
DSLESSSRGIYSGSIGFFSYNQTFDLNIVIRTIVIHDGEASIGAGGAIVALSNPEDEYDE
MLLKTRAPASAVIEFQ
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggctctgtgttcgtcgacttcgttggaactgaaaaatccttttattgagggcacgaaa
gggaaaatagcgacatccaagtcttttctaagagttggttatgttgccaagaatgagaaa
tcttgttgctgtaatggtagaaaggtggcggtatccagtcatttgatgcccggacattta
gaagggtcgttcatggaaaagaaacggctggaggagcctagccagaaaatggattttgtg
aggacattgttgattgacaactatgatagttatacctataatatttaccaagagctatct
gtcgttaatggggtgcctcctgtggtcatccaaaatgatgagtggacatgggaggatgcg
tgccattacttgtatgaaaagagagcttttgataatattgttatctcacctggacctggt
tctccaacatgcgcagcggatataggaatatgtcttcgactgctgctcgagtgcagggac
attcctattctgggtgtttgccttggacaccaggccttgggttatgtcaatggtgccaga
attgtccatgcatctgaaccagtccatggacgcttaagtgaaatcgaacataatggaagc
agactgtttgataacatcccttctggcagaaaatctggttttaaggtggtacggtatcat
tctctcatcatagattcagaagcactgccaaaggaacttataccgactgcttggacttct
agcagcactcattctttccttgagtctccgaattctggtcttaaccttgatgcgtgcaag
aatcagattaggccaagcacatcttctgatactttttcaacaggatcacacaatggagct
tcttggtcttttagccaccctggaagaatgcaagggggaaaagttctcatgggcattatg
cattctactaggccgcactatggcttacagtttcatccagaaagtattgcaacctgtcac
ggaaggcaaatatttgagaattttagagagattacagaggattattggcagagactgagg
ccaaggtcaacatttattaacgagagaaatgttcattatactgcatgcatgcaggtgcat
gttgctagtcagctgtttagagttcctagaattggatcattagtacacaaggaagatgct
caaccattcaaagaagcttttagaagaagccaattacttggaaatgccaacgtgaattgt
ctcagcatttccagtgcattgaagtttccagaatcaagcatcaacgttaggcatttaaag
ttgaaatggaggaaatttgataaattagcagcccgagttgggggagcaagaaacatattt
aacgaactgtttggggtttgtaaggctgaaaatacgttttggctggacagttcctcagta
gaaaagaaaagagcacgcttttcatttatggggggtaaagacggaccactttggaggcaa
atgacatttagattgtcagatcaaagtgatatggattttaaaggtggaggttacttatca
atcaaagatactcaaggatccaccgaaagcatgtttttggaaaaaggttttcttgatttt
ttgaaccaggagctactatcatttacttacgatgaagaagattttgaagaactgccattt
gactttcatggtggttatattggttacttcgggtatagcctcaaagttgaatgtggcatg
ttatccaaccgtcacaaatctacgactccagatgcttgctttttctttgcagataatttt
gtagtcatcgatcatcttaatgacaatgtttatatattgtctttacatgaggaaagcaca
accagcattccatggttggatgacacggaaaataagttgctttgcttagaagcttctacc
acaaggaaattaggggagcaggcttcccctactgcaacattttccccatacaaggcaggt
tttcttggtgagaaatctagagagcagtatattaaagatgttagtaagtgtctagaatac
attaaagatggggaaagctacgagttatgtctcacttctcagatgagaaaaacagttgga
gagatagattccttgggactttaccttcacctcagagagaaaaatccagcaccatatgct
gcgtggcttaatttttcaaatgaagatttgtgcatctgctgttcttctcctgagagattc
ctatgcttggacagaaatggtatattagaagcaaagccgattaaaggtaccatagctcgt
ggggtgaccctggaggaagatgaagagcttaaattgaaactgcagtacagtgaaaaggat
caagctgaaaatcttatgattgtcgatcttttgaggaacgatcttggtcgtgtctgtgag
cctggttctgttcatgtcccacatcttatggaagtagagtcgtatgcaactgtgcatact
atggtgagtacaattcgaggaaagaagaggtcaaatgtaagtgcagttgactgtgtcagg
gctgcatttcctggtggctcaatgacaggtgcaccaaaattgagatcaatggagcttctc
gattctcttgaaagcagttctcgtgggatctactcaggttccattggatttttctcatat
aatcagacatttgatctgaatatagtgataagaacaatagttattcatgacggtgaagct
tctataggtgcaggaggagctattgttgctctatcaaatcctgaagacgaatacgatgaa
atgttactgaaaacacgagcaccagcaagcgcagtgatagaatttcagtag

DBGET integrated database retrieval system