KEGG   Populus trichocarpa (black cottonwood): 7458787Help
Entry
7458787           CDS       T01077                                 

Definition
(RefSeq) ethylene-responsive transcription factor ERF043
  KO
K09286  EREBP-like factor
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pop03000]
    7458787
Transcription factors [BR:pop03000]
 Eukaryotic type
  Other transcription factors
   EREBP
    7458787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AP2
Motif
Other DBs
NCBI-GeneID: 7458787
NCBI-ProteinID: XP_002324441
UniProt: B9ILS4
LinkDB All DBs
Position
18
AA seq 293 aa AA seqDB search
MTVSPVSNSNSDTDSTSTYSSSLQALSSSSSSGLSPNPVSKPDPEENPRKPKRPRESTST
SSNSNSKHPVFRGVRMRTWGKWVSEIREPRKKNRIWLGTFSTPEMAARAHDVAALSIKGN
SAILNFPKLAGSLPRPASNSPRDVQAAAAKAASMDFNIVPSAPTKVCDDENNSNSNDSTA
SNNNRSSSSLVTQSSSSPSSSSTAEVTSSPSDVATPEELSEIVELPSLETNLEEFPEFVL
LGDSWPYNINQSWYCEDYGAVGTGYFSDQYLSIIPESNVITTTGAFETSLWEH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttcgccggtatcaaactccaactccgacacagactccacaagcacttactcc
tcctccttgcaagccctgtcttcctcatcttcatcaggattatcaccaaacccggtgtct
aaacccgacccggaagaaaacccaagaaaaccaaagaggccaagagaaagcaccagcacc
agcagcaacagcaacagcaagcacccggtattcaggggggtccgaatgcggacatgggga
aaatgggtgtcggagatccgggagcccagaaagaagaatcggatctggctaggcaccttt
tccaccccagagatggcagcacgtgcccatgacgtggcagccttgagcattaaaggcaac
tcagccatcctcaatttccccaaacttgccgggtctctgccacgacccgcttctaactct
ccacgtgatgtccaagctgccgccgcaaaagccgcttctatggacttcaacattgttcct
tcggctcccaccaaagtctgcgacgatgaaaataacagtaacagcaacgactctacggcg
agtaataataaccggtcatcatcctcgctagtgacacagtcctcctcctccccgtcctca
tcgtcaacagcagaggtgacatcatcaccaagtgacgtggcgactcctgaagaactgagc
gagatagttgagttgccgagtctggaaacaaatctcgaggaatttcctgagtttgttttg
cttggtgactcgtggccgtacaatattaaccagtcctggtattgtgaggactacggtgct
gtgggtactgggtattttagcgatcagtatttgtcaataattccagaaagtaatgtgatt
acgactactggagcttttgagacttcattgtgggagcattaa

DBGET integrated database retrieval system