KEGG   Populus trichocarpa (black cottonwood): 7461391Help
Entry
7461391           CDS       T01077                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00061  Fatty acid biosynthesis
pop00780  Biotin metabolism
pop01100  Metabolic pathways
pop01212  Fatty acid metabolism
Module
pop_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    7461391
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    7461391
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    7461391
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pop01004]
    7461391
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     7461391
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     7461391
Lipid biosynthesis proteins [BR:pop01004]
 Fatty acid synthase
  Component type
   7461391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 7461391
NCBI-ProteinID: XP_002304026
LinkDB All DBs
Position
3
AA seq 394 aa AA seqDB search
MAATAASGLQMATARPCISSSHRVVKAGAAILGASSKGASWAKLASGSHISSIQPFQRTF
MSSSVKLNKVVTKATSESSDSKPVSGLPIDLRGKRAFIAGVADDNGYGWAIAKSLAASGA
EILVGTWVPALNIFETSLRRGKFDESRVLPDGSLMDITKVYPLDAVFDNPEDVPEDVKAN
KRYAGSSKWTVQEVAESVKQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYS
YVSLLKHFLPIMNPGGSSISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKNR
IRVNTISAGPLRSRAAKAIGFIDTMIEYSLANAPLQKELSADEVGNAAAFLASPLASAVT
GTVMYVDNGLNTMGVGVDSPIFKDLDIPKDNHQG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaactgcggcttctggccttcaaatggcaactgcaaggccctgcatttcctct
tcccacagagtggtcaaggcaggtgctgctattcttggagccagttctaaaggggcatca
tgggctaagcttgcgagtggttctcatatatcgtctattcagcctttccaaaggactttc
atgtcatcttcagttaaattgaataaggttgtgacaaaggcaacgtctgaatctagtgac
agtaagccagtgtctggattgccaattgatttgagaggtaaacgggcatttattgctggt
gtagctgatgacaatgggtatggttgggccatagcaaaatctcttgctgcttcaggtgct
gaaattcttgtcggaacatgggtgcctgctttgaacatttttgaaacaagcctgagacgg
gggaaatttgatgaatctcgcgtgttgccagatggttctttgatggatatcaccaaagta
tacccccttgatgcagtgtttgacaaccctgaggatgtacctgaagatgtgaaagcaaat
aaacgttatgctggatccagtaaatggactgttcaggaagttgctgaatctgtcaaacag
gattttggcagcattgacatccttgtgcactcgcttgccaatggaccggaggtcagcaaa
ccccttttggaaacatcaagaaaaggatatcttgcagccatatctgcatccagttactca
tatgtttctttactcaagcatttccttccaattatgaatccgggtggttcatctatttct
ctcacatacattgcttcagagaggatcataccaggatatggtggaggcatgagttctgcc
aaagctgcacttgaaagtgacacacgtgtgcttgcatttgaagcaggaaggaaaaacaga
atcagggtcaacacaatatctgctggtccactaagaagccgtgctgcaaaagcaattgga
tttattgatactatgattgaatattcattagccaatgcacccttgcaaaaagagctatct
gcagatgaggtgggcaatgctgctgccttcttagcatcacctttggcttctgcagtcact
ggtactgttatgtatgttgacaatggcctcaacacaatgggtgtcggagttgacagtccg
atattcaaagaccttgacattccaaaagacaatcaccagggttaa

DBGET integrated database retrieval system