KEGG   Populus trichocarpa (black cottonwood): 7466777Help
Entry
7466777           CDS       T01077                                 

Definition
(RefSeq) fatty acid amide hydrolase isoform X2
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 7466777
NCBI-ProteinID: XP_002309950
UniProt: A0A3N7FCH2
LinkDB All DBs
Position
7
AA seq 611 aa AA seqDB search
MGLFRAKGVVYKPVENVNLGPDSDESYIKANVKAPRMAGFLAKIFAWFLESRIFGAFLLY
ILKRNNLIHKLVTNAELEDSPVYVPLHPFEELNEKEVKHVNSDLSPSEQVQQAVGCLPLP
SEKIVNGLKPSSRRWTVMDYSKAYSSGEITPYKVAERLVAAIHESSSPPLDMAFFINYDA
EDILRQAKESTLRYQRGEPRSVLDGVPVAIKDEIDCSPYPTTGGTKWLHKFRPCKSDAFC
ILRLRSCGVVIIGKTNMHELGAGTSGINPHYGATRNPYDPSRISGGSSSGSAAVVAAGLC
PVALGVDGGGSVRMPAALCGVVGFKPTFGRVPHSGVLPLNWTVGMVGVLAGTIEDALIVY
AAINGPVPSHETSVIPPPKMYFPMLQSTNSVSDITLARYGEWFNDCSDDIRTCCSLALHK
LSEKHGWKTVDVTIPDIEAMRLAHYLTIGSECTAALSSYLEKLDIAESGWDVRVALSVYG
AFSGEDYIKAQKLRNRQIQFHRNIFTKADVIVTPTVGVTAYPILNDALHTGELDYINGAA
LVRYQIAGNFLGLPAVTVPVGYDKKGLPIGLQFIGRPWSEPTLIHIAHAMQTLCISEYRK
PQAFYDLLKKD
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggggttgttcagagctaagggtgtggtttacaagcctgttgagaatgttaatcttggc
cctgatagtgatgaatcctatataaaagccaatgttaaagctcctcgcatggctggattt
cttgccaagattttcgcctggtttctcgagtcgcgaattttcggagcattccttctgtac
atcttgaagagaaacaatctaattcacaagcttgttacaaatgcagagctggaggattca
cctgtctatgtccctttgcatccatttgaagagctcaatgaaaaagaagtcaaacacgta
aattctgatctatcaccatctgaacaagttcagcaggcagttggttgtctgcctctacct
tcagagaagattgttaatggattgaagccatcttcccgtcgctggacagtaatggattat
tctaaagcatatagctctggagaaataactccatacaaggttgcagaacgactagtagct
gcaatccatgaatcttccagtcctccattggacatggcattctttattaattatgatgct
gaagatattttaaggcaggctaaagaatcaactcttcggtatcaaagaggggagccaaga
tcggttctagatggagttccagttgcaatcaaggatgaaatagactgtagcccttatcca
acaacaggaggcactaagtggttgcacaaatttagaccttgcaaaagtgatgccttctgc
attttgcgcctcagatcatgtggtgtggtaattattggaaaaaccaatatgcacgagctt
ggcgctggaacaagtggaataaatcctcactatggggctactagaaatccatacgatcct
agcaggatatctggaggttcttctagtggatcagctgcagtggttgctgcaggactttgc
cctgttgcccttggtgttgatgggggaggatccgtgagaatgccagcagctctttgtggt
gttgttggtttcaaaccaactttcgggcgtgtacctcactctggtgttcttcctctgaac
tggacagtggggatggtaggagtgttagcaggcacaatagaggatgcattaatcgtttat
gcagctataaatggcccagttccatcccatgaaacctctgttataccaccgccaaagatg
tatttcccaatgctacaatcaacaaattcagtgtcagacatcacattggcaagatacggg
gagtggtttaatgattgcagtgatgatattagaacatgctgttccctagcattgcacaag
ctttctgagaagcatggttggaagactgtagatgttaccataccagacatagaggcgatg
cgcctcgcacattatttaacaattggatctgagtgcaccgctgctcttagttcttatcta
gaaaagttggatattgcagagtcaggatgggatgtaagggtagcacttagtgtttatggt
gctttcagtggtgaagattatataaaggctcagaaacttaggaaccgccagatacaattt
cacaggaatatatttacaaaagcagatgtaattgttacaccaacagtaggcgtaactgca
taccctattttgaatgatgctctccatactggtgagctggactacataaatggagctgcg
ctagttcggtatcagatagcaggaaattttctgggattacctgcagttactgttccggtt
ggatatgacaaaaaagggttgcctataggccttcaatttattggaaggccatggtctgaa
ccaacattaatccacatagcacatgctatgcagactctgtgcatctcagagtacagaaaa
ccacaggctttctatgatttgctcaagaaggattaa

DBGET integrated database retrieval system