KEGG   Populus trichocarpa (black cottonwood): 7469338Help
Entry
7469338           CDS       T01077                                 

Definition
(RefSeq) indole-3-glycerol phosphate synthase, chloroplastic
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01230  Biosynthesis of amino acids
Module
pop_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    7469338
Enzymes [BR:pop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     7469338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS ThiG NanE
Motif
Other DBs
NCBI-GeneID: 7469338
NCBI-ProteinID: XP_002321203
UniProt: B9IAU9
LinkDB All DBs
Position
14
AA seq 387 aa AA seqDB search
MAGLISLRSTRVPFLTKPKPSPLHHGPNNFSMNPNPGAGNRFSVTSIKAQQAEASTVNKE
DELKAKEWEVRMLQEEVAASQGIRIRRRPPTGPPVHYVGPFEFRIQSEGNTPRNILEEIV
WNKDVEVSHMKQRKPLSSLKKYLENAPPTRDFVGALREANHRTGFPGLIAEVKKASPSRG
ILREDFDPVEIAKAYEKGGAACLSVLTDEKYFKGSFENLEAIRNAGVKCPLLCKEFVVDA
WQIFYARIKGADAILLIAAVLPDLDIKYMTKICKMLGLTALVEVHDEREMDRVLAIEGVE
LIGINNRNLETFEVDISNTKKLLEGERGQLICQKDIIVVGESGLFTPDDIAYVQEAGVKA
VLVGESIVKQSDPGKGISGLFGKDISL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcggggttgatttctttgagatcaacaagggttcctttccttaccaaacccaaacct
tctcctctccatcacgggcccaacaacttctccatgaacccaaacccgggtgccgggaat
cggttttccgttacctccattaaagctcaacaggctgaggcttcaacagtgaacaaggaa
gatgagctaaaagcgaaggaatgggaagtgaggatgctgcaagaagaggtagctgcaagc
caaggtataagaatcagacgaaggccacccactggcccacctgtgcactatgtgggaccc
tttgaatttcggattcagagtgaaggcaacactcctcgtaacatccttgaggaaattgtt
tggaacaaggatgtggaagtttctcacatgaaacagagaaagccactttcttcgctaaag
aaatatcttgagaatgctcctcccacaagggattttgttggagctcttagggaagcaaat
catcgaacggggtttcctggtttgattgctgaagtcaagaaggcttcaccaagtagaggg
attttaagagaggattttgatcctgttgaaattgccaaagcttacgagaaaggaggagcc
gcgtgtcttagtgttttgacagatgaaaaatattttaaggggagctttgaaaacctggag
gcaataagaaatgctggagtaaagtgccccctgctttgcaaagagtttgttgtggacgca
tggcagatcttctatgctcggattaaaggtgcagatgcgattcttttaattgctgctgtt
cttcctgatcttgacatcaaatacatgactaagatatgcaagatgcttggtttgactgca
cttgtggaggtccatgatgagagagaaatggatcgcgtacttgcaatagaaggggtcgaa
cttattggcatcaacaatcgtaaccttgaaacatttgaggttgatatcagtaacacaaag
aagcttcttgaaggagagcgcggtcaacttatctgtcaaaaagacataattgttgttggg
gaatctgggctatttactcctgatgatattgcttatgtgcaagaagctggtgtcaaagca
gttttggttggggagtcaattgtgaaacagagtgatcctgggaagggaatatcaggactt
tttggtaaagatatctccttgtaa

DBGET integrated database retrieval system