KEGG   Populus trichocarpa (black cottonwood): 7470533Help
Entry
7470533           CDS       T01077                                 

Definition
(RefSeq) uncharacterized protein LOC7470533
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: T4bSS_IcmS
Motif
Other DBs
NCBI-GeneID: 7470533
NCBI-ProteinID: XP_002299680
UniProt: B9GF89
LinkDB All DBs
Position
1
AA seq 642 aa AA seqDB search
MNLIKKGPRFSHNNELPKNDCFGDTALSLNCLGYGGSSSTNAEGADNNLKVDFSNASDDG
CKLVLGLGPTPSAYFDDCYSFGVNKNKGLASGAIFPKGLLSESDSILKLGLSGGAKEALS
GLGCAIEGTDTDTPMLNQISGDDIRVPIPVVDEGSTSAKKSGGYIASLLLAPRMDVGKAL
SQTELLNFGTGSHHQFQLSHELPANADFSVGTTSEQAISSTSSDHRTKIPKKCKFFGCSK
GARGASGLCIGHGGGQRCHKPGCNKGAESRTAYCKAHGGGRRCQHLGCTKSAEGKTENCI
AHGGGRRCGFPGGCAKAARGKSGLCIRHGGGKRCKVEGCTRSAEGQAGLCISHGGGRRCL
HQACTKGAQGSTMFCKAHGGGRRCIFAGCSKGAEGSTPLCKGHGGGKRCLFDGGGICPKS
VHGGTDFCVAHGGGKRCVVPGCTKSARGRTDCCVRHGGGKRCKFEDCGKSAQGSTDFCKA
HGGGKRCTWGEGKCEKFARGKSGLCAAHSSMVQERKANKTGLIGPGLFHGLVSASSVAGS
SIDTNHSYSGVSAVSDSIDSLEKPAKRQHLIPAQVLVPLSMKVSSSCTGFMNTENLEEGT
NGYGASNGGIKGCDYLVPEGRVHGGALMSLFGGNLKNSIDGV
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttatcaaaaagggcccacgattttctcataataatgagcttccaaagaatgac
tgttttggtgataccgctttgagcttgaactgccttggatatggaggaagcagttcgacc
aatgctgagggcgctgataataatcttaaagttgatttctctaatgcttctgatgacggt
tgcaagttggtgcttggattgggtccaacaccaagtgcatattttgatgattgttacagc
tttggggtcaacaaaaataaagggctggcttctggtgctatatttcccaaggggctgttg
tctgagagcgattcaatcctaaaacttggcctttctggaggggctaaggaagctttgagt
ggtctcggctgtgcaattgaggggactgatacagatactcctatgctgaaccaaatttct
ggtgatgatattagagtcccgattcctgttgtcgatgagggttccacctcagcaaagaag
tctggtggctatatagcatcacttcttttggctcctagaatggatgttggaaaagctctg
tcacagacagaacttctcaactttgggactggatcgcatcatcaatttcagctgagccat
gaactacctgccaacgcagatttctctgtgggcactacttctgagcaagcgatttcatcc
acttcttctgaccacagaactaaaattccaaagaaatgcaagttctttggttgctcaaag
ggagcacggggggcatcaggcctttgtattggtcacgggggcggacagcgatgccataag
ccaggttgcaacaagggagctgagagccgaacagcatattgcaaggcccatggtggagga
agaaggtgtcaacacttgggttgcactaaaagcgcagaggggaagacagaaaattgcatc
gcccatggtggtggcagaagatgtgggtttccagggggatgcgctaaggctgcacgaggc
aagtcagggctttgtattagacatggcggggggaagaggtgtaaggttgaaggctgcacc
cgtagtgctgaaggacaggctgggttgtgtatttctcatgggggtggacgccgttgtttg
caccaagcatgtacgaagggtgctcaggggagtaccatgttctgcaaagctcatggtggg
ggaaggcgatgcatatttgcaggatgcagcaaaggagccgaagggagtacgccgttgtgc
aagggacatggtgggggaaagcgctgcctgtttgatggtggtggaatttgtccaaaaagt
gtccatggagggacagacttttgtgttgcccatggtggtggaaagaggtgtgttgtgcca
ggctgtacaaagagtgcgcgtggccgtactgattgttgtgtcaggcatggtggtgggaag
cggtgcaagtttgaagattgtgggaagagtgcccaaggcagcactgatttctgcaaggct
catggcgggggtaaacgatgtacctggggtgagggaaaatgtgagaagtttgccaggggt
aagagtggtctatgtgctgcgcacagcagcatggtccaagagaggaaggcaaacaagact
ggtttgatcggaccaggactgttccatggccttgtatctgcttcgtcagttgcagggagc
agcatagacaccaaccattcatattctggagtcagtgctgtctcggactccattgattcc
ctagaaaagccagcaaaaagacaacatctgataccagcacaagtactggttcctctttca
atgaaggtctcttcgtcttgtacaggttttatgaatactgagaacctagaggaaggtaca
aatggctatggtgccagcaatggtgggataaagggttgtgattatctggttcccgaggga
agagtccatggcggcgcccttatgtcattgttcggtggaaatctaaagaattcaatcgat
ggagtttga

DBGET integrated database retrieval system