KEGG   Populus trichocarpa (black cottonwood): 7471448Help
Entry
7471448           CDS       T01077                                 

Definition
(RefSeq) protein SHOOT GRAVITROPISM 5
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_6 zf-MYST zf-C2H2_4 zf-met zf-H2C2_2 zf-C2H2_jaz DUF2524 V-ATPase_G_2
Motif
Other DBs
NCBI-GeneID: 7471448
NCBI-ProteinID: XP_024461730
LinkDB All DBs
Position
8
AA seq 424 aa AA seqDB search
MLDSTTTSTAPSPSSDPFTTSLDNGVTNKRKRKPAGTPDPDAEVVSLSPRTLLESDRYVC
EICNQGFQRDQNLQMHRRRHKVPWKLLKRETQEVKKRVYVCPEPSCLHHDPCHALGDLVG
IKKHFRRKHSNHKQWVCEKCSKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRVESFIEHQ
DACTVRGAQPELQALQPACSSRTASSTSPSSDANFNIAPLPGIPMSKPTEQVYLCSDRND
ASTSSQQEHNLELQLLPSSSNHLPQNPDEPHAANLKLSIGSSDHSCEKDGSNKAIGDPSW
HKSTSNEPAFEAAKLKEFTNEQLRLAMTEKAYAEEARQQAKRQIEMAELEFANAKRIRQQ
AQSELEKAQLLKEQATKKLSSTIMQVTCQVCKQQFHASTAAAPADETSLAMSYMSSATTE
GDGE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacagcaccaccacttcaactgctccatctccttcctctgatcccttcacaact
tccttggataatggggtcaccaataaaagaaaaagaaaacctgcaggcacaccagatcca
gatgcagaggttgtatctctatcgcccaggaccctactagaatcagacagatatgtctgt
gagatctgcaaccaagggtttcaaagagaccagaaccttcaaatgcacaggagaaggcac
aaggtgccatggaagctactgaaaagggagacacaagaagtgaagaagagagtttatgta
tgcccagagccaagctgcttacatcatgacccttgccatgctttaggagatcttgttggc
ataaagaagcattttagaaggaagcatagtaatcacaagcagtgggtttgtgagaagtgt
tctaagggttacgcggttcagtctgattacaaagctcacctcaagacttgtggcacaaga
ggtcattcttgtgactgtggccgtgtcttttccagggtggagagtttcattgagcaccaa
gatgcttgcacagtaaggggagcccagcctgaactacaggcattgcagccggcctgctca
tctagaactgcttcaagcaccagcccttcaagtgatgccaattttaacatagcaccctta
ccagggataccaatgtcaaagccaaccgaacaagtttacttgtgctcggatagaaatgat
gcgtctacttctagtcagcaagaacataatcttgaacttcagctcttaccatcttcaagc
aatcacttaccacaaaaccctgacgagcctcatgctgcgaatttgaagctttcaataggg
tcaagtgatcatagttgcgaaaaggatggatcaaacaaggccattggggatccgagttgg
cataaaagcacctctaatgagcctgcattcgaagcagcaaagttaaaggagtttacaaat
gaacagttgaggttggctatgactgaaaaggcctatgccgaggaggctagacaacaagca
aagaggcaaattgagatggctgaactggaatttgcaaatgcaaagaggattaggcaacaa
gctcaatctgaacttgaaaaggctcaacttttgaaagagcaagctacaaagaaattaagt
tctaccattatgcaagtcacctgccaagtttgcaagcaacaattccacgcatcaactgct
gctgcaccggcagacgagacttctcttgctatgagttacatgtcctcagcaactactgaa
ggagatggagaatga

DBGET integrated database retrieval system