KEGG   Populus trichocarpa (black cottonwood): 7473625Help
Entry
7473625           CDS       T01077                                 

Definition
(RefSeq) zinc finger AN1 and C2H2 domain-containing stress-associated protein 11
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-AN1 zf-C2H2_4 zf-C2H2 zf-Di19 FOXP-CC zf-C2H2_9 zf-C2H2_11 Transp_Tc5_C zf-C2H2_6 zinc_ribbon_5
Motif
Other DBs
NCBI-GeneID: 7473625
NCBI-ProteinID: XP_002308952
UniProt: B9H9V6
LinkDB All DBs
Position
6
AA seq 292 aa AA seqDB search
MGTPQFPDLGKHCSVEDCKQIDFLPFTCDRCRQVFCLEHRSYIKHSCPKADSNGVIVVIC
PLCAKGVRLNPDEDPNISWEVHVNTECDPSNYDKVTKKRKCPVRGCRELLTFSNTIKCRD
CTLDHCLKHRFGPDHTCPGPKKPDVSFPFMGLLNRSKKEESKPNRATAVSSSKWTTNFLS
AASTVRASAEAGMSKLSSEISQAWQTATNSASPSSSNGSGGMGPEECPQCGTRFSSVTNL
IDHVQKVHEKGGNQSRVLQLPMEVCPKCSKGFRDPVALVEHVERDHRGTSKA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgggcactccacaattcccagatctaggaaaacattgctcagttgaagattgcaagcag
atcgatttcttgcctttcacttgtgatcgttgccgccaggtattttgtttggagcataga
agttatattaaacacagttgcccaaaagctgatagcaacggtgtcattgttgtcatctgt
ccattatgtgcgaagggagttcgcctaaaccctgacgaagacccaaacatttcttgggaa
gtgcatgttaatactgaatgtgacccttcaaattatgataaagttacaaagaagagaaaa
tgccctgtccggggttgcagggagctccttacattctcaaacacaatcaagtgccgggat
tgcacacttgaccattgcctgaaacaccggtttggaccagatcacacttgtcctggacca
aagaagcctgatgtgagctttccttttatgggtctcttgaataggagtaagaaggaagag
tcaaaacccaatcgagctacagctgtgtcttcatccaagtggaccactaactttcttagt
gctgcttcaactgttcgagcctcagctgaagcaggcatgtcgaaattgagcagtgagatc
agccaggcttggcagactgcaacaaatagtgcgagcccaagcagcagcaatggaagtgga
ggaatggggccagaggagtgtccgcagtgtggtacaaggttttcctcagtcacaaatctg
atagatcacgtgcagaaggtccatgaaaagggtggaaatcaatctcgtgtcttacagttg
ccaatggaggtatgcccaaagtgtagtaagggtttccgtgatcctgtggcgcttgtggag
catgttgagagagatcatagaggtacttccaaagcctag

DBGET integrated database retrieval system